(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5028

AL939122.SCO5028     Location/Qualifiers
FT   CDS             93012..94337
FT                   /transl_table=11
FT                   /gene="SCO5028"
FT                   /gene_synonym="SCK7.01"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCK7.01, possible ATP-binding protein, len: 441 aa;
FT                   similar to TR:Q9X792 (EMBL:AL049491) Mycobacterium leprae
FT                   putative ATP-binding protein MLCB1222.20, 433 aa; fasta
FT                   scores: opt: 2024 z-score: 2236.8 E(): 0; 72.2% identity in
FT                   428 aa overlap. Contains and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP8"
FT                   /protein_id="CAC05873.1"
FT                   /translation="MVTSTKRHKPDRRTYVLDTSVLLADPNALNRFDEHEVVLPIVVVT
FT                   ELEAKRHHPELGYFARQALRLLDEFRVRHGRLDAPIPIGDLGGTVRVELNHSDPSVLPT
FT                   GYRLGDNDSRILAVARNLQAEGFDVTVVSKDLPLRIKASSVGLLAEEYRAELAITDASG
FT                   WTGMSELTLPGEQVDVLFEEGRVYVPEAAGLPVHTGLTIQSERGKALGRVTPDGNVRLV
FT                   RGDREAFGIKGRSAEQRIALDLLLDPDVGIVSMGGRAGTGKSALALCAGLEAVLERRQH
FT                   QKVMVFRPLYAVGGQELGYLPGSEAEKMSPWAQAVFDTLSAVTSREVIEEVTARGMLEV
FT                   LPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRIGANSRVVLTHDVAQRDNLRVGRY
FT                   DGVVAVVEKLKGHPLFAHVTLTRSERSQIAALVTEMLEDGHI"
     MVTSTKRHKP DRRTYVLDTS VLLADPNALN RFDEHEVVLP IVVVTELEAK RHHPELGYFA        60
     RQALRLLDEF RVRHGRLDAP IPIGDLGGTV RVELNHSDPS VLPTGYRLGD NDSRILAVAR       120
     NLQAEGFDVT VVSKDLPLRI KASSVGLLAE EYRAELAITD ASGWTGMSEL TLPGEQVDVL       180
     FEEGRVYVPE AAGLPVHTGL TIQSERGKAL GRVTPDGNVR LVRGDREAFG IKGRSAEQRI       240
     ALDLLLDPDV GIVSMGGRAG TGKSALALCA GLEAVLERRQ HQKVMVFRPL YAVGGQELGY       300
     LPGSEAEKMS PWAQAVFDTL SAVTSREVIE EVTARGMLEV LPLTHIRGRS LHDAFVIVDE       360
     AQSLERNVLL TVLSRIGANS RVVLTHDVAQ RDNLRVGRYD GVVAVVEKLK GHPLFAHVTL       420
     TRSERSQIAA LVTEMLEDGH I                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page