(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5029

AL939122.SCO5029     Location/Qualifiers
FT   CDS             94767..95483
FT                   /transl_table=11
FT                   /gene="SCO5029"
FT                   /gene_synonym="SCK7.02"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.02, possible secreted protein, len: 238 aa;
FT                   similar to C-terminal region of TR:CAB93446 (EMBL:AL357591)
FT                   Streptomyces coelicolor hypothetical 16.0 kDa protein
FT                   SCC53.17, 154 aa; fasta scores: opt: 477 z-score: 484.5
FT                   E(): 1.6e-19; 64.4% identity in 101 aa overlap. Contains
FT                   possible N-terminal region signal peptide sequence and
FT                   possible coiled-coil region at aprox. residues 82..123"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP7"
FT                   /protein_id="CAC05874.1"
FT                   /translation="MLEGNRVSRISVRGFAVASATAVTAVGSVVGVASGSVAQNNDDAE
FT                   ATAAGTTLLADIPMGEQAQVQTASLTQQADVQAIAADASAKKDAEEAARKAAAKTAVDK
FT                   QEKAKKAAQAAKQREAQQEAASRDAKRESTSFAVQSSYSTSQIQAMARQMVPSGQFQCF
FT                   SNIVNHESSWNYQAVNASSGAYGLFQALPAGKYASAGADWRTNPATQIKWGLSYMDNRY
FT                   GSPCDAWAFWQANHWY"
     MLEGNRVSRI SVRGFAVASA TAVTAVGSVV GVASGSVAQN NDDAEATAAG TTLLADIPMG        60
     EQAQVQTASL TQQADVQAIA ADASAKKDAE EAARKAAAKT AVDKQEKAKK AAQAAKQREA       120
     QQEAASRDAK RESTSFAVQS SYSTSQIQAM ARQMVPSGQF QCFSNIVNHE SSWNYQAVNA       180
     SSGAYGLFQA LPAGKYASAG ADWRTNPATQ IKWGLSYMDN RYGSPCDAWA FWQANHWY         238
//

If you have problems or comments...

PBIL Back to PBIL home page