(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5030

AL939122.SCO5030     Location/Qualifiers
FT   CDS             95646..97043
FT                   /transl_table=11
FT                   /gene="SCO5030"
FT                   /gene_synonym="SCK7.03"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.03, possible integral membrane protein, len:
FT                   465 aa; similar to SW:Y205_MYCTU (EMBL:AL021928)
FT                   Mycobacterium tuberculosis hypothetical 38.0 kDa protein
FT                   MTV033.13, 367 aa; fasta scores: opt: 892 z-score: 833.4
FT                   E(): 0; 41.1% identity in 343 aa overlap. Contains Pfam
FT                   match to entry PF01594 UPF0118, Domain of unknown function
FT                   DUF20 and possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBP6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP6"
FT                   /protein_id="CAC05875.1"
FT                   /translation="MSRVPGWLGRLGAGLTRASERLEQRREEARRDDADDGPGPVSDHE
FT                   RRPLDDTAEDSAVEHLAAHRPVALAHRPDPAQAVPWGVRVAAEAGWRLLVLAGTVWVLM
FT                   RVISAVQLVVLAFVAALLITALLQPAVAWLRRHGVPRGPATALTAILGFVVMGLIGWFV
FT                   TWQVMENIDNLSDQVQDGIDELRNWLLNSPFHVTDKQINEIAKNLRDAVGANTDQITSA
FT                   GLEGVTVVVEALTGILLAAFSTLFLLYDGKRIWQWSLKLVPAAARPGVAGAGPRAWRTL
FT                   TAYVRGTVIVALIDAIFIGLGIYFLDVPMAVPLAVFIFLFAFIPLVGAVVSGALAVVVA
FT                   LVTQGVFAAVMTLVVVLAVQQIEGHILQPFILGRAVRVHPLAVVLSVAAGGMVAGIGGA
FT                   VVAVPLVAVTNTVVGYLRAYSREAALRRTPRPHGATSTDAAPAVDRVPGPPKPPAPPAD
FT                   GPPSDAP"
     MSRVPGWLGR LGAGLTRASE RLEQRREEAR RDDADDGPGP VSDHERRPLD DTAEDSAVEH        60
     LAAHRPVALA HRPDPAQAVP WGVRVAAEAG WRLLVLAGTV WVLMRVISAV QLVVLAFVAA       120
     LLITALLQPA VAWLRRHGVP RGPATALTAI LGFVVMGLIG WFVTWQVMEN IDNLSDQVQD       180
     GIDELRNWLL NSPFHVTDKQ INEIAKNLRD AVGANTDQIT SAGLEGVTVV VEALTGILLA       240
     AFSTLFLLYD GKRIWQWSLK LVPAAARPGV AGAGPRAWRT LTAYVRGTVI VALIDAIFIG       300
     LGIYFLDVPM AVPLAVFIFL FAFIPLVGAV VSGALAVVVA LVTQGVFAAV MTLVVVLAVQ       360
     QIEGHILQPF ILGRAVRVHP LAVVLSVAAG GMVAGIGGAV VAVPLVAVTN TVVGYLRAYS       420
     REAALRRTPR PHGATSTDAA PAVDRVPGPP KPPAPPADGP PSDAP                       465
//

If you have problems or comments...

PBIL Back to PBIL home page