(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5031

AL939122.SCO5031     Location/Qualifiers
FT   CDS             complement(97332..97868)
FT                   /transl_table=11
FT                   /gene="SCO5031"
FT                   /gene_synonym="ahpD"
FT                   /gene_synonym="SCK7.04c"
FT                   /product="alkyl hydroperoxide reductase system hypothetical
FT                   protein"
FT                   /note="SCK7.04c, ahpD, alkyl hydroperoxide reductase system
FT                   hypothetical protein, len: 178 aa; identical to previously
FT                   sequenced TR:Q9RN73 (EMBL:AF186371) Streptomyces coelicolor
FT                   A3(2) AhpD, 178 aa"
FT                   /db_xref="GOA:Q7AKI6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKI6"
FT                   /protein_id="CAC05876.1"
FT                   /translation="MSLDSLKSAVPDYAKDLKLNLGSVIGNSDLPAQQLWGTVLATAIA
FT                   SRSPIVLRELEPEAKANLSPEAYSAAKSAAAVMAMNNVFYRTRHLLSDHEYGTLRAGLR
FT                   MNVIGNPGVDKVDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAAVVE
FT                   AVGVTLDAEAVLAAE"
     MSLDSLKSAV PDYAKDLKLN LGSVIGNSDL PAQQLWGTVL ATAIASRSPI VLRELEPEAK        60
     ANLSPEAYSA AKSAAAVMAM NNVFYRTRHL LSDHEYGTLR AGLRMNVIGN PGVDKVDFEL       120
     WSFAVSAING CGMCLDSHEQ VLRKAGVDRE TIQEAFKIAA VVEAVGVTLD AEAVLAAE         178
//

If you have problems or comments...

PBIL Back to PBIL home page