(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5033

AL939122.SCO5033     Location/Qualifiers
FT   CDS             98567..99505
FT                   /transl_table=11
FT                   /gene="SCO5033"
FT                   /gene_synonym="oxyR"
FT                   /gene_synonym="SCK7.06"
FT                   /product="hydrogen peroxide sensing regulator"
FT                   /note="SCK7.06, oxyR, hydrogen peroxide sensing regulator,
FT                   len: 312 aa; identical to previously sequenced TR:Q9RN71
FT                   (EMBL:AF186371) Streptomyces coelicolor A3(2) hydrogen
FT                   peroxide sensing regulator OxyR, 313 aa. Contains Pfam
FT                   match to entry PF00126 HTH_1, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family and match to Prosite
FT                   entry S00044 Bacterial regulatory proteins, lysR family
FT                   signature. Also contains possible helix-turn-helix motif at
FT                   residues 23..44 (+3.89 SD)"
FT                   /db_xref="GOA:Q9FBP4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP4"
FT                   /protein_id="CAC05878.1"
FT                   /translation="MSSKKRQPSLAQLRAFDAVAEHLHFRDAAAAIGMSQPALSGAVSA
FT                   LEEALGVTLLERTTRKVLLSPAGARLAVRTKAVLAEVGALVEEAEAVRAPFTGALRLGV
FT                   IPTVAPYLLPTVLRLVHERYPDLDLQVHEEQTASLLEGLTTGRLDLLLLAVPLGVPGVT
FT                   ELPLFDEDFVLVTPLDHRLGGREGLERSVLRELKLLLLDEGHCLRDQALDICREAGRAG
FT                   VPATTTAAGLSTLVQLVAGGLGVTLLPRTAVRVETSRSSQLLTASFTDPAPTRRIALAM
FT                   RTGAARSAEYGELAAALREAMADLPVRTVHD"
     MSSKKRQPSL AQLRAFDAVA EHLHFRDAAA AIGMSQPALS GAVSALEEAL GVTLLERTTR        60
     KVLLSPAGAR LAVRTKAVLA EVGALVEEAE AVRAPFTGAL RLGVIPTVAP YLLPTVLRLV       120
     HERYPDLDLQ VHEEQTASLL EGLTTGRLDL LLLAVPLGVP GVTELPLFDE DFVLVTPLDH       180
     RLGGREGLER SVLRELKLLL LDEGHCLRDQ ALDICREAGR AGVPATTTAA GLSTLVQLVA       240
     GGLGVTLLPR TAVRVETSRS SQLLTASFTD PAPTRRIALA MRTGAARSAE YGELAAALRE       300
     AMADLPVRTV HD                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page