(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5034

AL939122.SCO5034     Location/Qualifiers
FT   CDS             complement(99633..101969)
FT                   /transl_table=11
FT                   /gene="SCO5034"
FT                   /gene_synonym="SCK7.07c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.07c, possible integral membrane protein, len:
FT                   778 aa; similar to TR:AAF74504 (EMBL:M34538) Streptomyces
FT                   clavuligerus hypothetical 42.6 kDa protein (fragment) 407
FT                   aa; fasta scores: opt: 509 z-score: 559.6 E(): 1.1e-23;
FT                   31.5% identity in 413 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP3"
FT                   /protein_id="CAC05879.1"
FT                   /translation="MRQWAADLMLGVRFAFTGGREGWTRAVLTAVGVGLGVALLLLTTA
FT                   LPNALTVRHDREAARSDITFATDPMPKADDTLVLARLDDTFRDDDVRGRALEPEGPRAP
FT                   LPPGLEKFPAVGEMVVSPALKKLLNSDSGALLRERLPDRVVGTIAEEGLIGSAELAYYR
FT                   GAEGLAEHITSGRIERIDRFGDPDPGEERSDPVLILLILVVFVVLLMPVAVFIAAAVRF
FT                   GGERRDRRLAALRLVGSDSRMTRRIAAGEAMAGAALGLLFGAGFFMVGRQLAGSAEVFR
FT                   ISVFPSYLNPSPVLALLVAVAVPTAAVLVTLLALRGVVIEPLGVVRAGRPARRQLWWRL
FT                   ILPLAGLAMLYPMIGNGRENGDFNQYLVTGGVVLLLVGVTALLPWVVESVVARLGSGGV
FT                   AWQLAVRRLQLSSGTAARMVNGIAVAVAGAIALQMLFAGVDDDYTKSTGQDVSWAQMEA
FT                   ILPSGVPMDQAAAKFRDTKGVEAVNAFSEGWLGDRPKDPDHGTTLTVGDCASLREIARL
FT                   SSCAEGDVFVVHGAEWDAEEDVTKLAAPGRKLYVDPSYEGIPKRHEIPWTVPQGVKAAK
FT                   PRTGLLAGTDRGGLLITRKAMPEALAPALDGHAYLRLDQSVPDVHDLVRNTTVAIDPLA
FT                   DAVAWAATERTDRFDAIRTGLFVGAACVLALIGASLLVSQLEQLRERKKLLSALVAFGT
FT                   RRRTLSLSVLWQTAIPIVLGLLLASVVGLTLGTVLLKMTSTPVSVDWTGVLAMTGIGAA
FT                   VVLVVTLCSLPPLLRLMRPEGLRTE"
     MRQWAADLML GVRFAFTGGR EGWTRAVLTA VGVGLGVALL LLTTALPNAL TVRHDREAAR        60
     SDITFATDPM PKADDTLVLA RLDDTFRDDD VRGRALEPEG PRAPLPPGLE KFPAVGEMVV       120
     SPALKKLLNS DSGALLRERL PDRVVGTIAE EGLIGSAELA YYRGAEGLAE HITSGRIERI       180
     DRFGDPDPGE ERSDPVLILL ILVVFVVLLM PVAVFIAAAV RFGGERRDRR LAALRLVGSD       240
     SRMTRRIAAG EAMAGAALGL LFGAGFFMVG RQLAGSAEVF RISVFPSYLN PSPVLALLVA       300
     VAVPTAAVLV TLLALRGVVI EPLGVVRAGR PARRQLWWRL ILPLAGLAML YPMIGNGREN       360
     GDFNQYLVTG GVVLLLVGVT ALLPWVVESV VARLGSGGVA WQLAVRRLQL SSGTAARMVN       420
     GIAVAVAGAI ALQMLFAGVD DDYTKSTGQD VSWAQMEAIL PSGVPMDQAA AKFRDTKGVE       480
     AVNAFSEGWL GDRPKDPDHG TTLTVGDCAS LREIARLSSC AEGDVFVVHG AEWDAEEDVT       540
     KLAAPGRKLY VDPSYEGIPK RHEIPWTVPQ GVKAAKPRTG LLAGTDRGGL LITRKAMPEA       600
     LAPALDGHAY LRLDQSVPDV HDLVRNTTVA IDPLADAVAW AATERTDRFD AIRTGLFVGA       660
     ACVLALIGAS LLVSQLEQLR ERKKLLSALV AFGTRRRTLS LSVLWQTAIP IVLGLLLASV       720
     VGLTLGTVLL KMTSTPVSVD WTGVLAMTGI GAAVVLVVTL CSLPPLLRLM RPEGLRTE         778
//

If you have problems or comments...

PBIL Back to PBIL home page