(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5035

AL939122.SCO5035     Location/Qualifiers
FT   CDS             complement(101972..102661)
FT                   /transl_table=11
FT                   /gene="SCO5035"
FT                   /gene_synonym="SCK7.08c"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SCK7.08c, possible ABC transporter ATP-binding
FT                   protein, len: 229 aa; similar to TR:CAB81857
FT                   (EMBL:AL161691) Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCD40A.12c, 246 aa; fasta
FT                   scores: opt: 597 z-score: 668.0 E(): 9.7e-30; 47.6%
FT                   identity in 206 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP2"
FT                   /protein_id="CAC05880.1"
FT                   /translation="MTPPAGSLLSADQLRKAYGPTLALDGAEFSIHPGEVVAVMGPSGS
FT                   GKSTLLHCLAGIVPPDSGTITYNGRELSAMSDAQRSALRRSDFGFVFQFGQLVPELTCV
FT                   ENVALPLRLNGTSRKEAERAALSWMERLEVDDLRKKRPGEVSGGQGQRVAVARSLVTNP
FT                   RVLFADEPTGALDSLNGERVMELLTDAARSTNAAVVLVTHEARVAAYSDREIVVRDGKS
FT                   RDMERAV"
     MTPPAGSLLS ADQLRKAYGP TLALDGAEFS IHPGEVVAVM GPSGSGKSTL LHCLAGIVPP        60
     DSGTITYNGR ELSAMSDAQR SALRRSDFGF VFQFGQLVPE LTCVENVALP LRLNGTSRKE       120
     AERAALSWME RLEVDDLRKK RPGEVSGGQG QRVAVARSLV TNPRVLFADE PTGALDSLNG       180
     ERVMELLTDA ARSTNAAVVL VTHEARVAAY SDREIVVRDG KSRDMERAV                   229
//

If you have problems or comments...

PBIL Back to PBIL home page