(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5036

AL939122.SCO5036     Location/Qualifiers
FT   CDS             complement(102658..103182)
FT                   /transl_table=11
FT                   /gene="SCO5036"
FT                   /gene_synonym="SCK7.09c"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.09c, hypothetical protein, len: 174 aa; similar
FT                   to TR:O50432 (EMBL:AL010186) Mycobacterium tuberculosis
FT                   hypothetical 21.1 kDa protein MTV005.12c, 189 aa; fasta
FT                   scores: opt: 183 z-score: 238.8 E(): 7.8e-06; 30.1%
FT                   identity in 186 aa overlap"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP1"
FT                   /protein_id="CAC05881.1"
FT                   /translation="MSIGHTLLGLLESGPRHGYDLKRAFDEKFGHDRPLHYGQVYSTMS
FT                   RLLKNGLVVVDGIEAGGGPERKRYAITDEGITDVQRWLATPEKPEPYLQSTLYTKVVLA
FT                   LLTHRDAADILDTQRSEHLRSMRILTDRKRKGDLADQLICDHALFHLEADLRWLELTAA
FT                   RLDKLREAVTR"
     MSIGHTLLGL LESGPRHGYD LKRAFDEKFG HDRPLHYGQV YSTMSRLLKN GLVVVDGIEA        60
     GGGPERKRYA ITDEGITDVQ RWLATPEKPE PYLQSTLYTK VVLALLTHRD AADILDTQRS       120
     EHLRSMRILT DRKRKGDLAD QLICDHALFH LEADLRWLEL TAARLDKLRE AVTR             174
//

If you have problems or comments...

PBIL Back to PBIL home page