(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5037

AL939122.SCO5037     Location/Qualifiers
FT   CDS             complement(103366..103671)
FT                   /transl_table=11
FT                   /gene="SCO5037"
FT                   /gene_synonym="SCK7.10c"
FT                   /product="hypothetical protein SCK7.10c"
FT                   /note="SCK7.10c, unknown, len: 101 aa. Highly hydrophilic.
FT                   Also high in G+C content (80.52 %)"
FT                   /db_xref="GOA:Q9FBP0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP0"
FT                   /protein_id="CAC05882.1"
FT                   /translation="MTSPPEDSAPEDSVRDSAPSEGPAPKRRPHQRKQVLLRLDPQVYE
FT                   ALARWAGDELRSANAQIEFLLRRALAEAGRLPGGTGPLPRRGRPPGGGGPGAAPPP"
     MTSPPEDSAP EDSVRDSAPS EGPAPKRRPH QRKQVLLRLD PQVYEALARW AGDELRSANA        60
     QIEFLLRRAL AEAGRLPGGT GPLPRRGRPP GGGGPGAAPP P                           101
//

If you have problems or comments...

PBIL Back to PBIL home page