(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5039

AL939122.SCO5039     Location/Qualifiers
FT   CDS             105026..107176
FT                   /transl_table=11
FT                   /gene="SCO5039"
FT                   /gene_synonym="SCK7.12"
FT                   /product="putative penicillin-binding protein"
FT                   /note="SCK7.12, possible penicillin-binding protein, len:
FT                   773 aa; similar to TR:CAB88838 (EMBL:AL353832) Streptomyces
FT                   coelicolor probable penicillin-binding protein SCE6.34, 756
FT                   aa; fasta scores: opt: 1080 z-score: 911.6 E(): 0; 46.0%
FT                   identity in 733 aa overlap and to SW:PBPD_BACSU
FT                   (EMBL:U11882) Bacillus subtilis penicillin-binding protein
FT                   4 precursor PbpD, 624 aa; fasta scores: opt: 513 z-score:
FT                   438.2 E(): 6.1e-17; 28.7% identity in 582 aa overlap.
FT                   Contains Pfam matches to entries PF00912 Transglycosyl,
FT                   Transglycosylase and PF00905 Transpeptidase, Penicillin
FT                   binding protein transpeptidase domain and 2x matches to
FT                   Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="GOA:Q9FBN9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN9"
FT                   /protein_id="CAC05884.1"
FT                   /translation="MGAFIVLYMMIDIPEGNPEADLQSNVYKYSDGSIMARTGERNREI
FT                   VDLAKIPKDVQRTFVAAENKTFYNDAGVDLKGTARGVLNTLSGKGAQGGSTITQQYVKN
FT                   YYLTQEQTVSRKLKELVISLKLDREKSKDYILAGYINTSYYGRGAYGIQAAAQAYYRVD
FT                   AEDLTVEQGAYLSALLQAPNQYDWAIASETGKKLVQQRWNYVLDNMVEQKWLGAGDRQG
FT                   MKFPEPKEPKAAAGKEGQVGYLVDAADHALKKQLVAQGAAEDMEQAKALVDLGGYTVTL
FT                   NIDKKKQAALEAAVKKQLTSKLDPDERKVDADVQAGAASVDPKTGSVVAMYGGVNYLKH
FT                   FTNNATRDDYQPASTFKPVILAAAVDHDAETQDGVPITANTLYDGDSERPVMDGDKKVG
FT                   FAPPNEDDHDYGEIDVQEAMNKSVNSVFAQMGIDVGMPEVMKVAADLGMDTEGEQAVPA
FT                   QTLGSMGASPLEMAGVYATFDNHGKKVTPAIVKSVEHKDRKVEMPDPIGEQVISREAAD
FT                   TVTSVLTGVVNDGTAKKSVRENPLRDGQKVAGKTGTSDNNKSAWFSGFTPGLVTSVGLF
FT                   GEDDEPPHKQVPMYKAAGVDYRVNGGGPPAEIWAAYTFGVMDEVTEFDLETKQGAAVRP
FT                   SKSPTAPESPTKSPTREETSEAPPPSSDPTTEAPPSSDPTTEEPPESPTNSPSNSPSTE
FT                   PPPDGGSTESGDPELPGVDWGQ"
     MGAFIVLYMM IDIPEGNPEA DLQSNVYKYS DGSIMARTGE RNREIVDLAK IPKDVQRTFV        60
     AAENKTFYND AGVDLKGTAR GVLNTLSGKG AQGGSTITQQ YVKNYYLTQE QTVSRKLKEL       120
     VISLKLDREK SKDYILAGYI NTSYYGRGAY GIQAAAQAYY RVDAEDLTVE QGAYLSALLQ       180
     APNQYDWAIA SETGKKLVQQ RWNYVLDNMV EQKWLGAGDR QGMKFPEPKE PKAAAGKEGQ       240
     VGYLVDAADH ALKKQLVAQG AAEDMEQAKA LVDLGGYTVT LNIDKKKQAA LEAAVKKQLT       300
     SKLDPDERKV DADVQAGAAS VDPKTGSVVA MYGGVNYLKH FTNNATRDDY QPASTFKPVI       360
     LAAAVDHDAE TQDGVPITAN TLYDGDSERP VMDGDKKVGF APPNEDDHDY GEIDVQEAMN       420
     KSVNSVFAQM GIDVGMPEVM KVAADLGMDT EGEQAVPAQT LGSMGASPLE MAGVYATFDN       480
     HGKKVTPAIV KSVEHKDRKV EMPDPIGEQV ISREAADTVT SVLTGVVNDG TAKKSVRENP       540
     LRDGQKVAGK TGTSDNNKSA WFSGFTPGLV TSVGLFGEDD EPPHKQVPMY KAAGVDYRVN       600
     GGGPPAEIWA AYTFGVMDEV TEFDLETKQG AAVRPSKSPT APESPTKSPT REETSEAPPP       660
     SSDPTTEAPP SSDPTTEEPP ESPTNSPSNS PSTEPPPDGG STESGDPELP GVDWGQ           716
//

If you have problems or comments...

PBIL Back to PBIL home page