(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5041

AL939122.SCO5041     Location/Qualifiers
FT   CDS             complement(109825..110535)
FT                   /transl_table=11
FT                   /gene="SCO5041"
FT                   /gene_synonym="SCK7.14c"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.14, hypothetical protein, len: 236 aa; similar
FT                   to TR:O83033 (EMBL:AB016934) Streptomyces wedmorensis FomD
FT                   protein, 209 aa; fasta scores: opt: 282 z-score: 320.1 E():
FT                   2.3e-10; 34.5% identity in 197 aa overlap"
FT                   /db_xref="GOA:Q9FBN7"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="PDB:3CBT"
FT                   /db_xref="PDB:3EXM"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN7"
FT                   /protein_id="CAC05886.1"
FT                   /translation="MTDGEAVSAAAGPGAEGPPGPVGHWAPGSHILWRYRENGGPHVHI
FT                   ARPVTVVRDDADLLAVWLAPGTECVKPVLADGTPVHLEPLATRYTKPRTVQRDQWFGTG
FT                   VLKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWH
FT                   WRDEDEFAQALRDGLMDPASAGRVRRAGRSAVAEIRAWGSPFADGWEHWRPDPAWPVPS
FT                   LPGDWDRTPAHVSS"
     MTDGEAVSAA AGPGAEGPPG PVGHWAPGSH ILWRYRENGG PHVHIARPVT VVRDDADLLA        60
     VWLAPGTECV KPVLADGTPV HLEPLATRYT KPRTVQRDQW FGTGVLKLAR PGEAWSVWLF       120
     WDPGWRFKNW YVNLERPLTR WEGGVDSEDH FLDISVHPDR TWHWRDEDEF AQALRDGLMD       180
     PASAGRVRRA GRSAVAEIRA WGSPFADGWE HWRPDPAWPV PSLPGDWDRT PAHVSS           236
//

If you have problems or comments...

PBIL Back to PBIL home page