(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5042

AL939122.SCO5042     Location/Qualifiers
FT   CDS             complement(110624..112009)
FT                   /transl_table=11
FT                   /gene="SCO5042"
FT                   /gene_synonym="fumC"
FT                   /gene_synonym="SCK7.15c"
FT                   /product="fumarate hydratase C"
FT                   /note="SCK7.15c, fumC, fumarate hydratase C, len: 461 aa;
FT                   similar to SW:FUMC_PSEAE (EMBL:U59458) Pseudomonas
FT                   aeruginosa fumarate hydratase C (EC 4.2.1.2) FumC, 458 aa;
FT                   fasta scores: opt: 1505 z-score: 1638.8 E(): 0; 53.6%
FT                   identity in 459 aa overlap. Contains Pfam match to entry
FT                   PF00206 lyase_1, Lyase and match to Prosite entry PS00163
FT                   Fumarate lyases signature"
FT                   /db_xref="GOA:Q9FBN6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBN6"
FT                   /protein_id="CAC05887.1"
FT                   /translation="MSEYRIEHDSMGEVRVPADAKWRAQTQRAVENFPVSGQRIERAHI
FT                   EALARIKSAAAKVNAELGVLDEDVAGAIQEAAGEVAEGKWDEHFPVDVFQTGSGTSSNM
FT                   NTNEVVATLATERLGRDVHPNDHVNASQSSNDVFPSSIHIAATAAVTRDLIPALDHLAG
FT                   ALERKAGEFADVVKSGRTHLMDATPVTLGQEFGGYAAQVRYGIERLQASLPRLAELPLG
FT                   GTAVGTGINTPPGFSAAVIEEVARATGLPLTEARDHFEAQGARDGIVETSGQLRTIGVG
FT                   LTKIANDLRWMASGPRTGLAEISLPDLQPGSSIMPGKVNPVIPEAVLMVAAQVTGNDAT
FT                   VAAAGAAGNFELNVMLPVIAKNVLESVRLLANVSRLLADRTVDGIVAHPERAREYAESS
FT                   PSVVTPLNKYLGYEEAAKVAKRALAERKTIRQTVLEGGYVERGDLTREQLDQALDVLRM
FT                   TRP"
     MSEYRIEHDS MGEVRVPADA KWRAQTQRAV ENFPVSGQRI ERAHIEALAR IKSAAAKVNA        60
     ELGVLDEDVA GAIQEAAGEV AEGKWDEHFP VDVFQTGSGT SSNMNTNEVV ATLATERLGR       120
     DVHPNDHVNA SQSSNDVFPS SIHIAATAAV TRDLIPALDH LAGALERKAG EFADVVKSGR       180
     THLMDATPVT LGQEFGGYAA QVRYGIERLQ ASLPRLAELP LGGTAVGTGI NTPPGFSAAV       240
     IEEVARATGL PLTEARDHFE AQGARDGIVE TSGQLRTIGV GLTKIANDLR WMASGPRTGL       300
     AEISLPDLQP GSSIMPGKVN PVIPEAVLMV AAQVTGNDAT VAAAGAAGNF ELNVMLPVIA       360
     KNVLESVRLL ANVSRLLADR TVDGIVAHPE RAREYAESSP SVVTPLNKYL GYEEAAKVAK       420
     RALAERKTIR QTVLEGGYVE RGDLTREQLD QALDVLRMTR P                           461
//

If you have problems or comments...

PBIL Back to PBIL home page