(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5043

AL939122.SCO5043     Location/Qualifiers
FT   CDS             complement(112101..113561)
FT                   /transl_table=11
FT                   /gene="SCO5043"
FT                   /gene_synonym="SCK7.16c"
FT                   /product="putative hydrolase (putative membrane protein)"
FT                   /note="SCK7.16c, probable hydrolase (putative membrane
FT                   protein), len: 486 aa; N-terminal similar to SW:APX_STRGR
FT                   Streptomyces griseus aminopeptidase (EC 3.4.11.-), 284 aa;
FT                   fasta scores: opt: 967 z-score: 1057.3 E(): 0; 53.7%
FT                   identity in 283 aa overlap and C-terminal region similar to
FT                   TR:O69311 (EMBL:D84193) Streptomyces lividans chitinase (EC
FT                   3.2.1.14) ChiB, 610 aa; blastp scores: Score = 87 (30.6
FT                   bits), Expect = 2.1, P = 0.87; Identities = 46/159 (28%),
FT                   Positives = 60/159 (37%). Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9FBN5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN5"
FT                   /protein_id="CAC05888.1"
FT                   /translation="MRTCPAWPPLSHFWRTKVKRRFAVASLSLAVVLGLGTLPAVAAGT
FT                   APAAQSPDVDVTKVKAHLTELHSIAGRNGGTRRSTGQGYRDSVAYVKGKLQAAGYTVTE
FT                   QPCTSGCSSGAGPNLIAEWPHGDANDVYMFGAHLDSVSAGPGMNDNGSGSAALLENALT
FT                   LARQNPTMQGRVRFAWWTDEEQGLNGSDFYVRSLSSAQRSAITAYYNFDMIASTNGGYF
FT                   VNHVTSAAAAPMKAYWDSLGLQPEENTEGAGRSDDYSFEQYGIPTSGYAMGASARKTSA
FT                   QAAKWGGTAGTSYDPCYHRSCDNLDNINTTGLDRASDGIAYTIWQRAVGTGDDGGGDGC
FT                   DTDPVVNGGFESGSSPWTGDTGTIGAHSGQSAHTGTRFAWLAGYGSTHTESVAQTVTVP
FT                   TGCTRLAYWLHIDTDESGTTAYDTFKVKADGTTLATLSNADARDGYVQRTVDLGAYAGR
FT                   QVALSFTGSEDGSLQTGFVLDDVSLLAG"
     MRTCPAWPPL SHFWRTKVKR RFAVASLSLA VVLGLGTLPA VAAGTAPAAQ SPDVDVTKVK        60
     AHLTELHSIA GRNGGTRRST GQGYRDSVAY VKGKLQAAGY TVTEQPCTSG CSSGAGPNLI       120
     AEWPHGDAND VYMFGAHLDS VSAGPGMNDN GSGSAALLEN ALTLARQNPT MQGRVRFAWW       180
     TDEEQGLNGS DFYVRSLSSA QRSAITAYYN FDMIASTNGG YFVNHVTSAA AAPMKAYWDS       240
     LGLQPEENTE GAGRSDDYSF EQYGIPTSGY AMGASARKTS AQAAKWGGTA GTSYDPCYHR       300
     SCDNLDNINT TGLDRASDGI AYTIWQRAVG TGDDGGGDGC DTDPVVNGGF ESGSSPWTGD       360
     TGTIGAHSGQ SAHTGTRFAW LAGYGSTHTE SVAQTVTVPT GCTRLAYWLH IDTDESGTTA       420
     YDTFKVKADG TTLATLSNAD ARDGYVQRTV DLGAYAGRQV ALSFTGSEDG SLQTGFVLDD       480
     VSLLAG                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page