(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5044

AL939122.SCO5044     Location/Qualifiers
FT   CDS             complement(113742..115418)
FT                   /transl_table=11
FT                   /gene="SCO5044"
FT                   /gene_synonym="fumB"
FT                   /gene_synonym="SCK7.17c"
FT                   /product="fumarate hydratase class I"
FT                   /note="SCK7.17c, fumB, fumarate hydratase class I, len: 558
FT                   aa; similar to SW:FUMB_ECOLI (EMBL:M27058) Escherichia coli
FT                   fumarate hydratase class I, anaerobic (EC 4.2.1.2) FumB,
FT                   548 aa; fasta scores: opt: 2386 z-score: 2782.7 E(): 0;
FT                   64.9% identity in 539 aa overlap. Contains Pfam match to
FT                   entry PF00206 lyase_1, Lyase and match to Prosite entry
FT                   PS00163 Fumarate lyases signature"
FT                   /db_xref="GOA:Q9FBN4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN4"
FT                   /protein_id="CAC05889.1"
FT                   /translation="MGEMPEFAYTDLLPQGEDTTPYRLVTAEGVATFEADGRTFLKVEP
FT                   EALRKLAEEAVHDIQHYLRPAHLAQLRRIIDDPEASGNDKFVALDLLKNANIAAAGVLP
FT                   MCQDTGTAIVMGKRGQNVLTEGGDEEALSRGIYDAYKNLNLRYSQMAPLTMWEEKNTGS
FT                   NLPAQIELYATDGGAYKFLFMAKGGGSANKSFLYQETKAVLNESSMMKFLEEKIRSLGT
FT                   AACPPYHLAIVVGGTSAEYALKTAKYASAHYLDEIPAEGSELGHGFRDKELEEKVFELT
FT                   QKIGIGAQFGGKYFCHDVRVVRLPRHGASCPVAIAVSCSADRQAVAKITAEGVFLEQLE
FT                   TDPARFLPETTDEHLEEEGDVVKVDLNQPMDDILAELTRHPVKTRLSLTGPLVVARDIA
FT                   HAKIKERLDAGEEMPQYLKDHPVYYAGPAKTPEGYASGSFGPTTAGRMDSYVEQFQAAG
FT                   GSKVMLAKGNRSKQVTDACDAHGGFYLGSIGGPAARLAQDCIKKVEVVEYEELGMEAVW
FT                   KIEVEDFPAFIVVDDKGNDFFQDPAPAPTFTTIPVRGPGLA"
     MGEMPEFAYT DLLPQGEDTT PYRLVTAEGV ATFEADGRTF LKVEPEALRK LAEEAVHDIQ        60
     HYLRPAHLAQ LRRIIDDPEA SGNDKFVALD LLKNANIAAA GVLPMCQDTG TAIVMGKRGQ       120
     NVLTEGGDEE ALSRGIYDAY KNLNLRYSQM APLTMWEEKN TGSNLPAQIE LYATDGGAYK       180
     FLFMAKGGGS ANKSFLYQET KAVLNESSMM KFLEEKIRSL GTAACPPYHL AIVVGGTSAE       240
     YALKTAKYAS AHYLDEIPAE GSELGHGFRD KELEEKVFEL TQKIGIGAQF GGKYFCHDVR       300
     VVRLPRHGAS CPVAIAVSCS ADRQAVAKIT AEGVFLEQLE TDPARFLPET TDEHLEEEGD       360
     VVKVDLNQPM DDILAELTRH PVKTRLSLTG PLVVARDIAH AKIKERLDAG EEMPQYLKDH       420
     PVYYAGPAKT PEGYASGSFG PTTAGRMDSY VEQFQAAGGS KVMLAKGNRS KQVTDACDAH       480
     GGFYLGSIGG PAARLAQDCI KKVEVVEYEE LGMEAVWKIE VEDFPAFIVV DDKGNDFFQD       540
     PAPAPTFTTI PVRGPGLA                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page