(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5045

AL939122.SCO5045     Location/Qualifiers
FT   CDS             115654..116337
FT                   /transl_table=11
FT                   /gene="SCO5045"
FT                   /gene_synonym="SCK7.18"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.18, conserved hypothetical protein, len: 227
FT                   aa; similar to TR:CAB88834 (EMBL:AL353832) Streptomyces
FT                   coelicolor hypothetical 30.8 kDa protein SCE6.30c, 277 aa;
FT                   fasta scores: opt: 403 z-score: 468.8 E(): 1.2e-18; 38.6%
FT                   identity in 220 aa overlap"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN3"
FT                   /protein_id="CAC05890.1"
FT                   /translation="MDLHKHAPAAAPRTSELRASDADRDRVADMLREALAEGRLTADEH
FT                   AERVEGVLAAKTVGELDVFVRDLPAAHRGRETTAPAPHRPTAGAIPAEPDENVVAVFSS
FT                   AVRKGRWRANRRIHAYAVFGSIEIDLSEAVFEYQQVVIKAFSVFGSVEVRVPENVSVRG
FT                   AGGSVLGSFEVHTLDSSEAEAPVIYVDGWAVLGSVEARPKRGKVVADILDRVHRRVEKG
FT                   LRKHV"
     MDLHKHAPAA APRTSELRAS DADRDRVADM LREALAEGRL TADEHAERVE GVLAAKTVGE        60
     LDVFVRDLPA AHRGRETTAP APHRPTAGAI PAEPDENVVA VFSSAVRKGR WRANRRIHAY       120
     AVFGSIEIDL SEAVFEYQQV VIKAFSVFGS VEVRVPENVS VRGAGGSVLG SFEVHTLDSS       180
     EAEAPVIYVD GWAVLGSVEA RPKRGKVVAD ILDRVHRRVE KGLRKHV                     227
//

If you have problems or comments...

PBIL Back to PBIL home page