(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5049

AL939122.SCO5049     Location/Qualifiers
FT   CDS             complement(118832..119422)
FT                   /transl_table=11
FT                   /gene="SCO5049"
FT                   /gene_synonym="SCK7.22c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.22, hypothetical protein, len: 196 aa; similar
FT                   to TR:P75894 (EMBL:AE000202) Escherichia coli hypothetical
FT                   protein, 196 aa; fasta scores: opt: 466 z-score: 572.4 E():
FT                   2e-24; 40.6% identity in 192 aa overlap and to
FT                   SW:YDFN_BACSU (EMBL:AB001488) Bacillus subtilis putative
FT                   NAD(P)H nitroreductase YdfN, 206 aa; fasta scores: opt: 133
FT                   z-score: 170.9 E(): 0.047; 23.1% identity in 199 aa
FT                   overlap. Contains Pfam match to entry PF00881
FT                   Nitroreductase, Nitroreductase family. Similar also to
FT                   TR:Q9FBV0 (EMBL:AL391072) Streptomyces coelicolor putative
FT                   nitroreductase SC9A4.03c, 202 aa; fasta scores: opt: 599
FT                   Z-score: 706.0 E(): 1.1e-31; 49.474% identity in 190 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9FBN0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBN0"
FT                   /protein_id="CAC05894.1"
FT                   /translation="MSLVLDPAAQDLLFREARTANTFTDEPVTDEQVQAIYDLVKYGPT
FT                   AFNQSPLRITLVRSPEARERLVAHMAEGNRPKTAAAPLVAILSADNEFHEELPELFPHF
FT                   PAAKDAFFSERPVREGAATLNAALQAAYFIVGVRAAGLAAGPMTGLDFEGVRKEFLDDD
FT                   HTPLMVVNIGRPGPDAWFPRSPRLAYDQVVTTV"
     MSLVLDPAAQ DLLFREARTA NTFTDEPVTD EQVQAIYDLV KYGPTAFNQS PLRITLVRSP        60
     EARERLVAHM AEGNRPKTAA APLVAILSAD NEFHEELPEL FPHFPAAKDA FFSERPVREG       120
     AATLNAALQA AYFIVGVRAA GLAAGPMTGL DFEGVRKEFL DDDHTPLMVV NIGRPGPDAW       180
     FPRSPRLAYD QVVTTV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page