(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5050

AL939122.SCO5050     Location/Qualifiers
FT   CDS             119640..120971
FT                   /transl_table=11
FT                   /gene="SCO5050"
FT                   /gene_synonym="SCK7.23"
FT                   /product="putative nucleotide-sugar dehydrogenase"
FT                   /note="SCK7.23, possible nucleotide-sugar dehydrogenase,
FT                   len: 443 aa; similar to TR:CAB82012 (EMBL:AL161755)
FT                   Streptomyces coelicolor putative nucleotide-sugar
FT                   dehydrogenase SCD63.05c, 405 aa; fasta scores: opt: 736
FT                   z-score: 812.9 E(): 0; 36.2% identity in 423 aa overlap.
FT                   Contains Pfam match to entry PF00984 UDPG_MGDP_dh,
FT                   UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /db_xref="GOA:Q9FBM9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM9"
FT                   /protein_id="CAC05895.1"
FT                   /translation="MKFKSDSSHFDVSGPTVAVVGLGYVGLPTALALCDAGATVIGVDS
FT                   SPERLRDIARGAVDLLPLHHAQLACASAGDRFRLTPDATAVRDADAVVICVPTPVDARR
FT                   RPDLAALSAACASVVEHAVPGQLIVLTSTSYVGTTRDLLVEPLRARGLTVDEDVYVAFA
FT                   PERIDPGNERHTPERTPRLVGGAGPRSSRAAADLLAPTASAVRTVPDPETAEMAKLWEN
FT                   TYRAVNIALANELADACHSLGLAPAPVIEAAATKPYGFMPFYPGPGVGGHCIPCDPHYL
FT                   LWQLGKVRQQAPLVATALAANSRRPARITERALDLLADSAVPAHGARVLLIGVAYKEGV
FT                   ADVRESPALEILAGLAEAGAHVAYCDPLVPSLRVGADALHHLPDPHTRPWDLVVLNTVH
FT                   PVHDLTWLCADDAPPVLDTRQRGPLTKAAARAATGVPPAAEATA"
     MKFKSDSSHF DVSGPTVAVV GLGYVGLPTA LALCDAGATV IGVDSSPERL RDIARGAVDL        60
     LPLHHAQLAC ASAGDRFRLT PDATAVRDAD AVVICVPTPV DARRRPDLAA LSAACASVVE       120
     HAVPGQLIVL TSTSYVGTTR DLLVEPLRAR GLTVDEDVYV AFAPERIDPG NERHTPERTP       180
     RLVGGAGPRS SRAAADLLAP TASAVRTVPD PETAEMAKLW ENTYRAVNIA LANELADACH       240
     SLGLAPAPVI EAAATKPYGF MPFYPGPGVG GHCIPCDPHY LLWQLGKVRQ QAPLVATALA       300
     ANSRRPARIT ERALDLLADS AVPAHGARVL LIGVAYKEGV ADVRESPALE ILAGLAEAGA       360
     HVAYCDPLVP SLRVGADALH HLPDPHTRPW DLVVLNTVHP VHDLTWLCAD DAPPVLDTRQ       420
     RGPLTKAAAR AATGVPPAAE ATA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page