(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5053

AL939122.SCO5053     Location/Qualifiers
FT   CDS             122532..124091
FT                   /transl_table=11
FT                   /gene="SCO5053"
FT                   /gene_synonym="SCK7.26"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.26, possible secreted protein, len: 519 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="GOA:Q9FBM6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM6"
FT                   /protein_id="CAC05898.1"
FT                   /translation="MSSDGSRGNRPRRMPDGRPLLRAALGLLTAAVVALPFTAAWQYDT
FT                   LRRAVAEQAAPPAPSSGDGGPGLGADAEPAPARNAPVVLAYHDVGPDDRSRYTVSPEHF
FT                   DAQLRALRDAGYRTLTTREFTGFLRTGRTPGPRTVHLTFDDGTHGLWTHADPVLARYGM
FT                   KAAAYLITGQVGTHRPYYLSWPEVERMARSGRWDFQAHTHLSHERAAVDAAGHERSVFT
FT                   NRLWLADEGRVETSDEYRRRVAADLDRSIRDLVRHDLPRPRLFAYPFSERLDESNLGAR
FT                   DADALRSMLRERFTATLTNSAARPLPAGPRAAAAGQVQRLEVTRDTTAAGLLRELGRWA
FT                   TVTPQDADRPLAHPAHWQTTGATGQAGPGMLTGGSRPPAGTAYASADYRPFATADWTDY
FT                   RLRAAVGGLHGTSNSAGITLRAGSGHPVSLSVGHHTASLTTADPETTGDRRSCRLKPSA
FT                   THRITVSVTPRHVRVSVDGETCAAVRAGRWRVAEGAGGFSLSVRNDGPERQWPRFTSLK
FT                   VR"
     MSSDGSRGNR PRRMPDGRPL LRAALGLLTA AVVALPFTAA WQYDTLRRAV AEQAAPPAPS        60
     SGDGGPGLGA DAEPAPARNA PVVLAYHDVG PDDRSRYTVS PEHFDAQLRA LRDAGYRTLT       120
     TREFTGFLRT GRTPGPRTVH LTFDDGTHGL WTHADPVLAR YGMKAAAYLI TGQVGTHRPY       180
     YLSWPEVERM ARSGRWDFQA HTHLSHERAA VDAAGHERSV FTNRLWLADE GRVETSDEYR       240
     RRVAADLDRS IRDLVRHDLP RPRLFAYPFS ERLDESNLGA RDADALRSML RERFTATLTN       300
     SAARPLPAGP RAAAAGQVQR LEVTRDTTAA GLLRELGRWA TVTPQDADRP LAHPAHWQTT       360
     GATGQAGPGM LTGGSRPPAG TAYASADYRP FATADWTDYR LRAAVGGLHG TSNSAGITLR       420
     AGSGHPVSLS VGHHTASLTT ADPETTGDRR SCRLKPSATH RITVSVTPRH VRVSVDGETC       480
     AAVRAGRWRV AEGAGGFSLS VRNDGPERQW PRFTSLKVR                              519
//

If you have problems or comments...

PBIL Back to PBIL home page