(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5055

AL939122.SCO5055     Location/Qualifiers
FT   CDS             complement(124413..124679)
FT                   /transl_table=11
FT                   /gene="SCO5055"
FT                   /gene_synonym="SCK7.28c"
FT                   /product="putative exoribonuclease"
FT                   /note="SCK7.28c, possible exoribonuclease small subunit,
FT                   len: 88 aa; similar to SW:EX7S_ECOLI (EMBL:D00694)
FT                   Escherichia coli exodeoxyribonuclease small subunit (EC
FT                   3.1.11.6) XseB, 79 aa; fasta scores: opt: 129 z-score:
FT                   174.2 E(): 0.031; 35.3% identity in 68 aa overlap and to
FT                   TR:Q9X784 (EMBL:AL049491) Mycobacterium leprae putative
FT                   exodeoxyribonuclease small subunit XseB, 87 aa; fasta
FT                   scores: opt: 231 z-score: 293.6 E(): 7e-09; 55.1% identity
FT                   in 78 aa overlap"
FT                   /db_xref="GOA:Q9FBM4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM4"
FT                   /protein_id="CAC05900.1"
FT                   /translation="MTSEVEQPTAMSEALGYEQARDELIEVVRRLEAGGTTLEESLALW
FT                   ERGEELAEVCRRRLDGARARLDAALAEEADPEDGASGADGGGA"
     MTSEVEQPTA MSEALGYEQA RDELIEVVRR LEAGGTTLEE SLALWERGEE LAEVCRRRLD        60
     GARARLDAAL AEEADPEDGA SGADGGGA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page