(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5056

AL939122.SCO5056     Location/Qualifiers
FT   CDS             complement(124689..125897)
FT                   /transl_table=11
FT                   /gene="SCO5056"
FT                   /gene_synonym="SCK7.29c"
FT                   /product="putative exoribonuclease large subunit"
FT                   /note="SCK7.29c, possible exoribonuclease large subunit,
FT                   len: 402 aa; similar to TR:O53456 (EMBL:AL021897)
FT                   Mycobacterium tuberculosis exonuclease VII large subunit
FT                   XseA or MTV017.61c, 415 aa; fasta scores: opt: 1318
FT                   z-score: 1486.0 E(): 0; 52.3% identity in 407 aa overlap
FT                   and to SW:EX7L_ECOLI (EMBL:J02599) Escherichia coli
FT                   exodeoxyribonuclease large subunit (EC 3.1.11.6) XseA, 456
FT                   aa; fasta scores: opt: 610 z-score: 689.7 E(): 6e-31; 30.8%
FT                   identity in 413 aa overlap"
FT                   /db_xref="GOA:Q9FBM3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM3"
FT                   /protein_id="CAC05901.1"
FT                   /translation="MAANSTPEGPLPVGEVSRLIGGWIDRLGAVWVEGQITQLSRRPGA
FT                   GVVFLTLRDPSYDISVSVTCYRQVFDAVADVVGEGARVVVHAKPEWYAPRGQLSLRAAE
FT                   IKPVGVGELLARLEQLKKALAREGLFAAERKQPLPFLPQLIGLVCGRASAAERDVLENA
FT                   RHRWPAVRFEVRNVPVQGVHAVPQVVQAVKELDARDDVDVIVVARGGGSVEDLLPFSDE
FT                   QLVRAVAACRTPVVSAIGHEPDSPLLDLVADLRASTPTDAAKKVVPDVGEEYERVRLLR
FT                   DRARRCVAAFVDREERGLAHALARPSIQDPHRMIEERAEQVTALLDRGRRSLRHHLDRA
FT                   DSELTHTHARVVALSPAATLKRGYAVLQRADGHAVRDPGEVEPGETLRARVSEGDFSVR
FT                   VDA"
     MAANSTPEGP LPVGEVSRLI GGWIDRLGAV WVEGQITQLS RRPGAGVVFL TLRDPSYDIS        60
     VSVTCYRQVF DAVADVVGEG ARVVVHAKPE WYAPRGQLSL RAAEIKPVGV GELLARLEQL       120
     KKALAREGLF AAERKQPLPF LPQLIGLVCG RASAAERDVL ENARHRWPAV RFEVRNVPVQ       180
     GVHAVPQVVQ AVKELDARDD VDVIVVARGG GSVEDLLPFS DEQLVRAVAA CRTPVVSAIG       240
     HEPDSPLLDL VADLRASTPT DAAKKVVPDV GEEYERVRLL RDRARRCVAA FVDREERGLA       300
     HALARPSIQD PHRMIEERAE QVTALLDRGR RSLRHHLDRA DSELTHTHAR VVALSPAATL       360
     KRGYAVLQRA DGHAVRDPGE VEPGETLRAR VSEGDFSVRV DA                          402
//

If you have problems or comments...

PBIL Back to PBIL home page