(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5058

AL939122.SCO5058     Location/Qualifiers
FT   CDS             127985..129001
FT                   /transl_table=11
FT                   /gene="SCO5058"
FT                   /gene_synonym="lytB"
FT                   /gene_synonym="SCBAC20F6.01"
FT                   /gene_synonym="SCK7.31"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC20F6.01, lytB, len: >148 aa; highly similar to
FT                   C-terminal region of SW:LYTB_ECOLI (EMBL:X54945)
FT                   Escherichia coli LytB protein LytB or B0029, 316 aa; fasta
FT                   scores: opt: 434  Z-score: 512.5  bits: 101.9 E(): 5.9e-21;
FT                   51.145% identity in 131 aa overlap. Contains Pfam match to
FT                   entry PF02401 LYTB, LytB protein"
FT                   /note="SCK7.31, hypothetical protein (fragment), len: >224
FT                   aa; similar to SW:LYTB_ECOLI (EMBL:AE000113) Escherichia
FT                   coli regulator, control of stringent response; involved in
FT                   penicillin tolerance LytB protein, 316 aa; fasta scores:
FT                   opt: 781 z-score: 922.7 E(): 0; 53.2% identity in 216 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9FBM1"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM1"
FT                   /protein_id="CAD55221.1"
FT                   /translation="MGAMTASPGRRVLLAAPRGYCAGVDRAVIAVEKALEQYGAPVYVR
FT                   HEIVHNKYVVQTLEKKGAIFVERTEEVPEGNIVMFSAHGVAPVVHEEAERGKLATIDAT
FT                   CPLVTKVHKEAVRFANDDYDILLIGHEGHEEVIGTSGEAPDHIQLVDGPEDVAKVEVRD
FT                   PSKVVWLSQTTLSVDETMETVDALKDKFPQLISPPSDDICYATQNRQLAVKQMGAEAEL
FT                   VIVVGSRNSSNSKRLVEVAKQAGSRAAYLVDFADEIDETWLDGVTTVGVTSGASVPDVL
FT                   VEQVLEWLSRRGFEDVEIVKAAEESIIFSLPKELRRDLREEAASLVAERGGSGTAGA"
     MGAMTASPGR RVLLAAPRGY CAGVDRAVIA VEKALEQYGA PVYVRHEIVH NKYVVQTLEK        60
     KGAIFVERTE EVPEGNIVMF SAHGVAPVVH EEAERGKLAT IDATCPLVTK VHKEAVRFAN       120
     DDYDILLIGH EGHEEVIGTS GEAPDHIQLV DGPEDVAKVE VRDPSKVVWL SQTTLSVDET       180
     METVDALKDK FPQLISPPSD DICYATQNRQ LAVKQMGAEA ELVIVVGSRN SSNSKRLVEV       240
     AKQAGSRAAY LVDFADEIDE TWLDGVTTVG VTSGASVPDV LVEQVLEWLS RRGFEDVEIV       300
     KAAEESIIFS LPKELRRDLR EEAASLVAER GGSGTAGA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page