(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5059

AL939122.SCO5059     Location/Qualifiers
FT   CDS             129055..129795
FT                   /transl_table=11
FT                   /gene="SCO5059"
FT                   /gene_synonym="ppgK"
FT                   /gene_synonym="SCBAC20F6.02"
FT                   /product="polyphosphate glucokinase"
FT                   /note="SCBAC20F6.02, ppgK, polyphosphate glucokinase, len:
FT                   246 aa; highly similar to SW:PPGK_MYCTU (EMBL:U44834)
FT                   Mycobacterium tuberculosis polyphosphate glucokinase (EC
FT                   2.7.1.63) PpgK or RV2702 or MTCY05A6.23, 265 aa; fasta
FT                   scores: opt: 912 Z-score: 1042.8 bits: 200.5 E(): 1.7e-50;
FT                   57.322% identity in 239 aa overlap. Contains Pfam match to
FT                   entry PF00480 ROK, ROK family"
FT                   /db_xref="GOA:Q9ADE8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE8"
FT                   /protein_id="CAC37447.1"
FT                   /translation="MQIFGVDIGGSGIKGAPVDLDRGDLAQERCKVLTPHPATPDGVAD
FT                   GVKQVVEHFGWTGRVGLTFPGVVTGGATVRTAANVDKGWVDTDARALFAERLGGLDVTV
FT                   VNDADAAGVAEMHFGAGRGRKGTVVLLTFGTGIGSAVFTDGLLVPNTELGHLELDGHDA
FT                   EKRASSKVKDDHDMSWEHWAHRVQKYLAHVEMLFSPELFIIGGGVSRKSQKFLPHIKDV
FT                   RAEIVPAQLQNNAGIVGAAMHAAG"
     MQIFGVDIGG SGIKGAPVDL DRGDLAQERC KVLTPHPATP DGVADGVKQV VEHFGWTGRV        60
     GLTFPGVVTG GATVRTAANV DKGWVDTDAR ALFAERLGGL DVTVVNDADA AGVAEMHFGA       120
     GRGRKGTVVL LTFGTGIGSA VFTDGLLVPN TELGHLELDG HDAEKRASSK VKDDHDMSWE       180
     HWAHRVQKYL AHVEMLFSPE LFIIGGGVSR KSQKFLPHIK DVRAEIVPAQ LQNNAGIVGA       240
     AMHAAG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page