(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5063

AL939122.SCO5063     Location/Qualifiers
FT   CDS             complement(132196..132447)
FT                   /transl_table=11
FT                   /gene="SCO5063"
FT                   /gene_synonym="SCBAC20F6.06c"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC20F6.06c, hypothetical protein, len: 83 aa;
FT                   similar to TR:Q9XAG7 (EMBL:AL079356) Streptomyces
FT                   coelicolor hypothetical 8.8 kDa protein SC6G9.07, 84 aa;
FT                   fasta scores: opt: 167  Z-score: 224.6  bits: 45.9 E():
FT                   6.3e-05; 43.103% identity in 58 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE4"
FT                   /protein_id="CAC37451.1"
FT                   /translation="MSGSRKYSISLPEDLAEAVRAHVGPGGFSAYVAEALEQRVAMDKL
FT                   REIVADFETDNEALTHEEVEAARALLRHDHRQAGGAAA"
     MSGSRKYSIS LPEDLAEAVR AHVGPGGFSA YVAEALEQRV AMDKLREIVA DFETDNEALT        60
     HEEVEAARAL LRHDHRQAGG AAA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page