(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5064

AL939122.SCO5064     Location/Qualifiers
FT   CDS             132446..134848
FT                   /transl_table=11
FT                   /gene="SCO5064"
FT                   /gene_synonym="SCBAC20F6.07"
FT                   /product="putative bifunctional protein"
FT                   /note="SCBAC20F6.07, possible bifunctional protein, len:
FT                   800 aa; N-terminal domain does not present similarity to
FT                   any known protein and C-terminal half is similar to the
FT                   C-terminal domain of may prokaryotic putative helicases,
FT                   e.g. TR:Q9CE08 (EMBL:AE006434) Lactococcus lactis (subsp.
FT                   lactis) SWI/SNF family helicase Snf, 1034 aa; fasta scores:
FT                   opt: 317  Z-score: 332.6  bits: 72.8 E(): 6.1e-11; 29.817%
FT                   identity in 436 aa overlap. Contains Pfam match to entry
FT                   PF00176 SNF2_N, SNF2 and others N-terminal domain and Pfam
FT                   match to entry PF00271 helicase_C, Helicase conserved
FT                   C-terminal domain"
FT                   /db_xref="GOA:Q9ADE3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE3"
FT                   /protein_id="CAC37452.1"
FT                   /translation="MVPILPAVVSLGGEWLPRGSVDQQGAVNARRGPVWAVERCGEGQR
FT                   GAGSVGRGERDTVARGTRLYEAAQAVVGDHARAVEAVRAALKPIHDEAVKRELDAIPVA
FT                   RLQDVTEGRLRLGSVEKSGLRTLGRVLEAGPYRLRQIPGVGQRTVDQILAAARRLSEAV
FT                   HETVAVHIDVDRPEPRTTALVMALHVLVEAGPEARRAVDKATVLTERLGPLLADAGPAA
FT                   GRVRMLLAGREKKARAWAAVAATRSLVDEAEQAGLPGLLAQASVDLLRGTASDVAAWVD
FT                   FELRSAEYYSLLAEISGRPPDAAAVEGFLPDEVAERVRTQHLDDTHRRVSLRGYQAFGA
FT                   RFALAQRKVILGDEMGLGKTIQAIAVLAHLAAEGQSHFMVVCPASVLVNWTREIEARSA
FT                   LRVMVLHGPDRHYAFADWKGRGGVGVTTFDALRGFPAPGGGEVGLLVVDEAHSVKNPKA
FT                   KRSQAVGLWAERCERTLFMTGTPMENRVAEFRNLVQMLDGDVADSLGERDALAGSVTFR
FT                   KAVAPVYLRRNQEDVLTELPSLQQTDEWEELSASDEEAYREAVRAGNFMAMRRAAYMSS
FT                   GNSAKLERLREIVQEAGENGQKTVVFSNFKDVLAVVKEALAVETTRVTPVFGPLTGGVP
FT                   AQRRQEIVDDFAGVQGPAVLLGQIQAAGVGLNMQAASVVVICEPQIKPTIEHQAVARAH
FT                   RMGQVRPVRVHRLLATGGVDERMVKMLEAKTRLFDAYARRSAVAEATPDAVDVSDTELA
FT                   RRIVEEEQARLGMTDERPTSSEWGVPRSAASPQDPLNGRRESTNANE"
     MVPILPAVVS LGGEWLPRGS VDQQGAVNAR RGPVWAVERC GEGQRGAGSV GRGERDTVAR        60
     GTRLYEAAQA VVGDHARAVE AVRAALKPIH DEAVKRELDA IPVARLQDVT EGRLRLGSVE       120
     KSGLRTLGRV LEAGPYRLRQ IPGVGQRTVD QILAAARRLS EAVHETVAVH IDVDRPEPRT       180
     TALVMALHVL VEAGPEARRA VDKATVLTER LGPLLADAGP AAGRVRMLLA GREKKARAWA       240
     AVAATRSLVD EAEQAGLPGL LAQASVDLLR GTASDVAAWV DFELRSAEYY SLLAEISGRP       300
     PDAAAVEGFL PDEVAERVRT QHLDDTHRRV SLRGYQAFGA RFALAQRKVI LGDEMGLGKT       360
     IQAIAVLAHL AAEGQSHFMV VCPASVLVNW TREIEARSAL RVMVLHGPDR HYAFADWKGR       420
     GGVGVTTFDA LRGFPAPGGG EVGLLVVDEA HSVKNPKAKR SQAVGLWAER CERTLFMTGT       480
     PMENRVAEFR NLVQMLDGDV ADSLGERDAL AGSVTFRKAV APVYLRRNQE DVLTELPSLQ       540
     QTDEWEELSA SDEEAYREAV RAGNFMAMRR AAYMSSGNSA KLERLREIVQ EAGENGQKTV       600
     VFSNFKDVLA VVKEALAVET TRVTPVFGPL TGGVPAQRRQ EIVDDFAGVQ GPAVLLGQIQ       660
     AAGVGLNMQA ASVVVICEPQ IKPTIEHQAV ARAHRMGQVR PVRVHRLLAT GGVDERMVKM       720
     LEAKTRLFDA YARRSAVAEA TPDAVDVSDT ELARRIVEEE QARLGMTDER PTSSEWGVPR       780
     SAASPQDPLN GRRESTNANE                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page