(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5065

AL939122.SCO5065     Location/Qualifiers
FT   CDS             complement(134937..137768)
FT                   /transl_table=11
FT                   /gene="SCO5065"
FT                   /gene_synonym="SCBAC20F6.08c"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCBAC20F6.08c, possible transcriptional regulator,
FT                   len: 943 aa; similar to many putative transcriptional
FT                   regulatory proteins, e.g. TR:Q9XAT8 (EMBL:U95170)
FT                   Rhodococcus erythropolis ThcG, 927 aa; fasta scores: opt:
FT                   1419 Z-score: 1371.5 bits: 265.1 E(): 8.4e-69; 35.446%
FT                   identity in 931 aa overlap. Contains Pfam match to entry
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family
FT                   and matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00622 Bacterial regulatory proteins,
FT                   luxR family signature. Also contains possible
FT                   helix-turn-helix motif at residues 893..914 (+3.76 SD)"
FT                   /db_xref="GOA:Q9ADE2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE2"
FT                   /protein_id="CAC37453.1"
FT                   /translation="MKNGERARAGHGSPAAPGPTAGPGPAPAPGPTVVGREAEIAEIRS
FT                   RIAADRSHSSVLIVEGDPGAGKSVLLDLAVRLTRGTGQRVLRAVGSESEASLAFAGLHQ
FT                   MLRPVLDDLGGLPARQRSALRTALGLAEDAEDAADTPDALLVGLAVLTLVSDLSEPAPL
FT                   LVVVDDAQWIDRASLDVLSFLARRMAGEPVTLLMGVRAAAVLPGFDKGYERLEIGPLSG
FT                   DAANRLLDEQPKRPTGRTRARILREAAGNPLALVELARATADREPEGSGVEGPLPVTDR
FT                   LEGIFARHVRHLPEATRRALLLLAAADAADAPAAARGLPEAADTVWAPAERAGLVRQDG
FT                   TGVSFRHPLVRSAVYHAAPFEQRRRAHLALARQLGEEPDRRAWHLAAAAVRPDEQVSAA
FT                   LRETAGRARRRGGHAAAAAALERAAELSPHRADQARLLADAADTAVFTGQLGWVEHLAA
FT                   GARERSDDPALIGRAALATGRLLTLGPHHTAAFALLSRVADEAAATRSPRLLDALAAAA
FT                   VVRYYSGEESQRQRIEALLADVPDSAAGGALRAWVLAVSDPSGAGASLAPALPRLIAAA
FT                   KGEAGSLTALAVVAWLLDRTPLAARTFDEAFGRWQAHGPLPAGLACAAGWAYLEQGRWA
FT                   DARSVAAEIAEVASGAGLDHAEACARTLDATVLALLGEPAEARGSAERALALVAPLESR
FT                   SVAVLARRALGLAAVAEGDYDSAYAQFRAAFTEDGDLVHYHVSPTVLAELAAAAVRRGH
FT                   REPAARLLERSARHLGPGMSARLFLLVERGRALLAEPERAERHFRAALAGEAGEQWPFE
FT                   RAQTRLDYGEWLRRQRRVAEARPLLTGALDTFRRLGARPWIDRAKAELRAAGIEADAAA
FT                   PGALTELSPQQQQIVRLAAHGLTNREIGERLFLSPRTVGSHLYRVFPKLGITARAQLRD
FT                   LLDDALQATGSAQ"
     MKNGERARAG HGSPAAPGPT AGPGPAPAPG PTVVGREAEI AEIRSRIAAD RSHSSVLIVE        60
     GDPGAGKSVL LDLAVRLTRG TGQRVLRAVG SESEASLAFA GLHQMLRPVL DDLGGLPARQ       120
     RSALRTALGL AEDAEDAADT PDALLVGLAV LTLVSDLSEP APLLVVVDDA QWIDRASLDV       180
     LSFLARRMAG EPVTLLMGVR AAAVLPGFDK GYERLEIGPL SGDAANRLLD EQPKRPTGRT       240
     RARILREAAG NPLALVELAR ATADREPEGS GVEGPLPVTD RLEGIFARHV RHLPEATRRA       300
     LLLLAAADAA DAPAAARGLP EAADTVWAPA ERAGLVRQDG TGVSFRHPLV RSAVYHAAPF       360
     EQRRRAHLAL ARQLGEEPDR RAWHLAAAAV RPDEQVSAAL RETAGRARRR GGHAAAAAAL       420
     ERAAELSPHR ADQARLLADA ADTAVFTGQL GWVEHLAAGA RERSDDPALI GRAALATGRL       480
     LTLGPHHTAA FALLSRVADE AAATRSPRLL DALAAAAVVR YYSGEESQRQ RIEALLADVP       540
     DSAAGGALRA WVLAVSDPSG AGASLAPALP RLIAAAKGEA GSLTALAVVA WLLDRTPLAA       600
     RTFDEAFGRW QAHGPLPAGL ACAAGWAYLE QGRWADARSV AAEIAEVASG AGLDHAEACA       660
     RTLDATVLAL LGEPAEARGS AERALALVAP LESRSVAVLA RRALGLAAVA EGDYDSAYAQ       720
     FRAAFTEDGD LVHYHVSPTV LAELAAAAVR RGHREPAARL LERSARHLGP GMSARLFLLV       780
     ERGRALLAEP ERAERHFRAA LAGEAGEQWP FERAQTRLDY GEWLRRQRRV AEARPLLTGA       840
     LDTFRRLGAR PWIDRAKAEL RAAGIEADAA APGALTELSP QQQQIVRLAA HGLTNREIGE       900
     RLFLSPRTVG SHLYRVFPKL GITARAQLRD LLDDALQATG SAQ                         943
//

If you have problems or comments...

PBIL Back to PBIL home page