(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5066

AL939122.SCO5066     Location/Qualifiers
FT   CDS             138078..138992
FT                   /transl_table=11
FT                   /gene="SCO5066"
FT                   /gene_synonym="SCBAC20F6.09"
FT                   /product="putative beta-lactamase"
FT                   /note="SCBAC20F6.09, possible beta-lactamase, len: 304 aa;
FT                   similar to TR:Q9X7X2 (EMBL:AL049485) Streptomyces
FT                   coelicolor putative beta-lactamase SC6E5.26c, 310 aa; fasta
FT                   scores: opt: 598 Z-score: 696.3 bits: 136.9 E(): 3.4e-31;
FT                   53.115% identity in 305 aa overlap and to SW:BLA1_XANMA
FT                   (EMBL:X75074) Xanthomonas maltophilia
FT                   metallo-beta-lactamase L1 precursor (beta-lactamase, type
FT                   II) (EC 3.5.2.6), 290 aa; fasta scores: opt: 146 Z-score:
FT                   175.9 bits: 40.6 E(): 0.033; 25.952% identity in 289 aa
FT                   overlap. Contains Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily and match to Prosite
FT                   entry PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE1"
FT                   /protein_id="CAC37454.1"
FT                   /translation="MDTITLGDVTVTRVREYYGPVGMTPEAFVPDSPAQAWDTHRSWLV
FT                   PDFLDAETRIVNTAIQTWVLRSEGRTILVDTGVGNHKDRPYAPVWSRLETDFLANLARA
FT                   GVQPEDVDIVINTHLHIDHVGWNTYLDGRTWVPTFPNATYLMAKADFDYWNPANEIKTL
FT                   LGRGNQNVFEDSVAPVHEAGLTRLWEDGHRIDSNLRLELAPGHTPGSSVLRLESGSDRG
FT                   LFVGDLMHSPIQIHEPDANSCFCEDPAEARATRRRLLGSAVDSNALVFPAHLGGHGAAE
FT                   VVREGGKFAVKGWAPFTPYTPSV"
     MDTITLGDVT VTRVREYYGP VGMTPEAFVP DSPAQAWDTH RSWLVPDFLD AETRIVNTAI        60
     QTWVLRSEGR TILVDTGVGN HKDRPYAPVW SRLETDFLAN LARAGVQPED VDIVINTHLH       120
     IDHVGWNTYL DGRTWVPTFP NATYLMAKAD FDYWNPANEI KTLLGRGNQN VFEDSVAPVH       180
     EAGLTRLWED GHRIDSNLRL ELAPGHTPGS SVLRLESGSD RGLFVGDLMH SPIQIHEPDA       240
     NSCFCEDPAE ARATRRRLLG SAVDSNALVF PAHLGGHGAA EVVREGGKFA VKGWAPFTPY       300
     TPSV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page