(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5067

AL939122.SCO5067     Location/Qualifiers
FT   CDS             139015..140508
FT                   /transl_table=11
FT                   /gene="SCO5067"
FT                   /gene_synonym="SCBAC20F6.10"
FT                   /product="putative carboxylesterase"
FT                   /note="SCBAC20F6.10, probable carboxylesterase, len: 497
FT                   aa; similar to SW:PNBA_BACSU (EMBL:U06089) Bacillus
FT                   subtilis para-nitrobenzyl esterase (EC 3.1.1.*) PnbA, 489
FT                   aa; fasta scores: opt: 784 Z-score: 827.6 bits: 162.6 E():
FT                   1.6e-38; 37.205% identity in 508 aa overlap. Contains 2x
FT                   Pfam matches to entry PF00135 COesterase, Carboxylesterase
FT                   and match to Prosite entry PS00122 Carboxylesterases type-B
FT                   serine active site"
FT                   /db_xref="GOA:Q9ADE0"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE0"
FT                   /protein_id="CAC37455.1"
FT                   /translation="MNHHPEPVVTTAQGAVRGLRQEDGTAAFLNIPYAAPPLGAGRFAP
FT                   PRPHEPWDGVRDATVPGPNAPQSERRLGSIDMAPYFGTGWSRGEDYLTVNVFTPATGAG
FT                   DLPVMVFVHGGGFVAGSTRSAMYDGSAFARDGVVLVTLNYRLGIAGFLDIPGAPANRGL
FT                   LDVVAALRWVRENVSAFGGNPHHVTLFGQSAGATVVGGVLATPEADGLFRRAIVQSGSG
FT                   LGAFTPEQAARVTAAAAQALGVEPHVDAFAGIPDERLVEAASGLAGIDLRTGTHFDPLI
FT                   GLSPFSLVLDTQPAASVAAGRAADVDLLVGTNTEEGNLYLVPVGKYATSTAADVDEAAA
FT                   RAHPDPAQLVAAYRTSRPEATFAELRSAVMADALFGAGSRALASAHATHPRAATYAYEF
FT                   AWRSRALDGELGATHAVELPFVFDLADRPELNGPAALLGPEQAPADLAARVHATWIRFA
FT                   RTGDPGWDPYDTDRRATMRIDAEWSQTDDPRSKEREVWS"
     MNHHPEPVVT TAQGAVRGLR QEDGTAAFLN IPYAAPPLGA GRFAPPRPHE PWDGVRDATV        60
     PGPNAPQSER RLGSIDMAPY FGTGWSRGED YLTVNVFTPA TGAGDLPVMV FVHGGGFVAG       120
     STRSAMYDGS AFARDGVVLV TLNYRLGIAG FLDIPGAPAN RGLLDVVAAL RWVRENVSAF       180
     GGNPHHVTLF GQSAGATVVG GVLATPEADG LFRRAIVQSG SGLGAFTPEQ AARVTAAAAQ       240
     ALGVEPHVDA FAGIPDERLV EAASGLAGID LRTGTHFDPL IGLSPFSLVL DTQPAASVAA       300
     GRAADVDLLV GTNTEEGNLY LVPVGKYATS TAADVDEAAA RAHPDPAQLV AAYRTSRPEA       360
     TFAELRSAVM ADALFGAGSR ALASAHATHP RAATYAYEFA WRSRALDGEL GATHAVELPF       420
     VFDLADRPEL NGPAALLGPE QAPADLAARV HATWIRFART GDPGWDPYDT DRRATMRIDA       480
     EWSQTDDPRS KEREVWS                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page