(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5072

AL939122.SCO5072     Location/Qualifiers
FT   CDS             144323..145246
FT                   /transl_table=11
FT                   /gene="SCO5072"
FT                   /gene_synonym="SCBAC20F6.15"
FT                   /product="hydroxylacyl-CoA dehydrogenase"
FT                   /note="SCBAC20F6.15, ORF1 hydroxylacyl-CoA dehydrogenase,
FT                   len: 307 aa; identical to previously sequenced TR:Q53926
FT                   (EMBL:X62373) Streptomyces coelicolor hydroxylacyl-CoA
FT                   dehydrogenase ORF1, 307 aa. Contains Pfam matches to
FT                   entries PF02737 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD binding domain and PF00725 3HCDH, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q7AKI1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI1"
FT                   /protein_id="CAC37460.1"
FT                   /translation="MSTVTVIGAGTIGLGWINLFSARGLTVRVNSRRPDVRRVVHEALE
FT                   LFSPGRVDELAARIEYEPDVGRAVAGADVVSENAPDDLPLKQRLFAEIGAAAPDHALVL
FT                   SSTSKLLPDELSRDMPGPGRLVVAHPFNPPHIVPLVEVVRGERTDPEAVERTLAFLASV
FT                   GRTPVVVRRALPGFAANRLQSALLRESIHLVLEGVVTVEELDRIVTDSIGLRWSTIGPF
FT                   HAFHLGGGPGGLRKWLEHLGSGLEQGWRGLGQPALTPQAVEALVAQTEAAYGHRPYAEL
FT                   VRDRDDRHLAVLAALERTEQPQEETK"
     MSTVTVIGAG TIGLGWINLF SARGLTVRVN SRRPDVRRVV HEALELFSPG RVDELAARIE        60
     YEPDVGRAVA GADVVSENAP DDLPLKQRLF AEIGAAAPDH ALVLSSTSKL LPDELSRDMP       120
     GPGRLVVAHP FNPPHIVPLV EVVRGERTDP EAVERTLAFL ASVGRTPVVV RRALPGFAAN       180
     RLQSALLRES IHLVLEGVVT VEELDRIVTD SIGLRWSTIG PFHAFHLGGG PGGLRKWLEH       240
     LGSGLEQGWR GLGQPALTPQ AVEALVAQTE AAYGHRPYAE LVRDRDDRHL AVLAALERTE       300
     QPQEETK                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page