(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5074

AL939122.SCO5074     Location/Qualifiers
FT   CDS             146299..146943
FT                   /transl_table=11
FT                   /gene="SCO5074"
FT                   /gene_synonym="SCBAC20F6.17"
FT                   /product="putative dehydratase"
FT                   /note="SCBAC20F6.17, possible dehydratase, len: 214 aa;
FT                   identical to previously sequenced TR:Q53928 (EMBL:X62373)
FT                   Streptomyces coelicolor ORF 3, 214 aa. Similar to TR:Q56172
FT                   (EMBL:L37334) putative dehydratase from granaticin
FT                   biosynthesis cluster of Streptomyces violaceoruber Tu22
FT                   (221 aa) fasta scores; opt: 349, Z-score: 400.9, E():
FT                   1.1e-14, 35.465% identity (37.195% ungapped) in 172 aa
FT                   overlap."
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD7"
FT                   /protein_id="CAC37462.1"
FT                   /translation="MTSSLHHAIRLTTASAIALGGLVTLGTSAHAASVAVPYECRTWVQ
FT                   GNTHPVYDYARGFDVSVPASVRAGKKFKATYDPDPITAFAEYNQIVNDVRIAYRIPDGA
FT                   KVHKVRLTGGSGLGDSDVRVQVKGRDIVVSASGPFQGGVEFDLPTLKVTYKAPKTTGPL
FT                   NFVSGGSGYEDPGFYWYRYQPILDEWGPFECFPDPAKPEAVLASTQVKKHK"
     MTSSLHHAIR LTTASAIALG GLVTLGTSAH AASVAVPYEC RTWVQGNTHP VYDYARGFDV        60
     SVPASVRAGK KFKATYDPDP ITAFAEYNQI VNDVRIAYRI PDGAKVHKVR LTGGSGLGDS       120
     DVRVQVKGRD IVVSASGPFQ GGVEFDLPTL KVTYKAPKTT GPLNFVSGGS GYEDPGFYWY       180
     RYQPILDEWG PFECFPDPAK PEAVLASTQV KKHK                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page