(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5079

AL939122.SCO5079     Location/Qualifiers
FT   CDS             150857..151741
FT                   /transl_table=11
FT                   /gene="SCO5079"
FT                   /gene_synonym="actVA4"
FT                   /gene_synonym="SCBAC28G1.05"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCBAC28G1.05, actVA4, conserved hypothetical
FT                   protein, len: 294 aa; identical to previously sequenced
FT                   TR:Q53906 (EMBL:X58833) Streptomyces coelicolor 6 ActVA
FT                   region genes of the actinorhodin biosynthetic gene cluster,
FT                   ActVA4, 294 aa"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH8"
FT                   /protein_id="CAC44192.1"
FT                   /translation="MPDENKPVLVLGATGKQGGSAARYLLERGWTVRAFVRDPGAPKAK
FT                   ELRELGASLHTGDLEDAGSVRAAMKGAYGVFSIQTPMTPAGVEGEERQGKICADAARDL
FT                   GVQHYVHSSVGGAERPEGVNWRLSKLAIEQRIQENALRFTFLRPSYFMENLNHDMSPLV
FT                   MEDGVLTFRRGLGPANTLQMISGPDIGYFAADAFDDPDTFGGAKIELAGDELTGEQIAA
FT                   AFGRHTGLPARFVSVPIPELHRTGFEWQAISYTWLNGIGYHADIPTLRARFPQLLTLDQ
FT                   WLARTGWTPRDPA"
     MPDENKPVLV LGATGKQGGS AARYLLERGW TVRAFVRDPG APKAKELREL GASLHTGDLE        60
     DAGSVRAAMK GAYGVFSIQT PMTPAGVEGE ERQGKICADA ARDLGVQHYV HSSVGGAERP       120
     EGVNWRLSKL AIEQRIQENA LRFTFLRPSY FMENLNHDMS PLVMEDGVLT FRRGLGPANT       180
     LQMISGPDIG YFAADAFDDP DTFGGAKIEL AGDELTGEQI AAAFGRHTGL PARFVSVPIP       240
     ELHRTGFEWQ AISYTWLNGI GYHADIPTLR ARFPQLLTLD QWLARTGWTP RDPA             294
//

If you have problems or comments...

PBIL Back to PBIL home page