(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5080

AL939122.SCO5080     Location/Qualifiers
FT   CDS             151738..152883
FT                   /transl_table=11
FT                   /gene="SCO5080"
FT                   /gene_synonym="actVA5"
FT                   /gene_synonym="SCBAC28G1.06"
FT                   /product="putative hydrolase"
FT                   /note="SCBAC28G1.06, actVA5, possible hydrolase, len: 381
FT                   aa; identical to previously sequenced TR:Q53907
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA5, 381
FT                   aa and similar to TR:Q9F0J3 (EMBL:AF218066) Streptomyces
FT                   arenae hydrolase NcnH, 405 aa; fasta scores: opt: 1391
FT                   Z-score: 1521.5 bits: 290.3 E(): 3.9e-77; 56.522% identity
FT                   in 368 aa overlap"
FT                   /db_xref="GOA:Q7AKH7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH7"
FT                   /protein_id="CAC44193.1"
FT                   /translation="MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAV
FT                   LRAGFAAHFVPVAHGGRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEG
FT                   QAELWSDGPDALIVGALMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPW
FT                   FFAVPRQEYGIVDSWYPMGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICH
FT                   TVPMRAVNGLAFALPMLGAARGAAAVWTSWTAGRLAGPTGQNAVSSQDRVVYEHTLARA
FT                   TGEIDAAQLLLERVAAVADAGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQA
FT                   QDSPMQRLWRDVHAAGSHIGLQFGPGAALYAGELLRRSNDG"
     MSEDTMTQER PSLTAHARRI AELAGKRAAD AEQQRRLSPD VVDAVLRAGF AAHFVPVAHG        60
     GRAATFGELV EPVAVLGEAC ASTAWYASLT ASLGRMAAYL PDEGQAELWS DGPDALIVGA       120
     LMPLGRAEKT PGGWHVSGTW PFVSVVDHSD WALICAKVGE EPWFFAVPRQ EYGIVDSWYP       180
     MGMRGTGSNT LVLDGVFVPD ARACTRAAIA AGLGPDAEAI CHTVPMRAVN GLAFALPMLG       240
     AARGAAAVWT SWTAGRLAGP TGQNAVSSQD RVVYEHTLAR ATGEIDAAQL LLERVAAVAD       300
     AGSATGVLVG RGARDCALAA ELLTAATDRL FASAGTRAQA QDSPMQRLWR DVHAAGSHIG       360
     LQFGPGAALY AGELLRRSND G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page