(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5081

AL939122.SCO5081     Location/Qualifiers
FT   CDS             152876..153217
FT                   /transl_table=11
FT                   /gene="SCO5081"
FT                   /gene_synonym="actVA6"
FT                   /gene_synonym="SCBAC28G1.07"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.07, actVA6, hypothetical protein, len: 113
FT                   aa; identical to previously sequenced TR:Q53908
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA6, 113
FT                   aa and similar to SW:TCMH_STRGA (EMBL:M80674) Streptomyces
FT                   glaucescens tetracenomycin polyketide synthesis hydroxylase
FT                   TcmH, 112 aa; fasta scores: opt: 193 Z-score: 247.6 bits:
FT                   51.0 E(): 3.5e-06; 43.210% identity in 81 aa overlap"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH6"
FT                   /protein_id="CAC44194.1"
FT                   /translation="MAEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPG
FT                   FLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFM
FT                   TPRGAILPS"
     MAEVNDPRVG FVAVVTFPVD GPATQHKLVE LATGGVQEWI REVPGFLSAT YHASTDGTAV        60
     VNYAQWESEQ AYRVNFGADP RSAELREALS SLPGLMGPPK AVFMTPRGAI LPS              113
//

If you have problems or comments...

PBIL Back to PBIL home page