(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5082

AL939122.SCO5082     Location/Qualifiers
FT   CDS             complement(153183..153962)
FT                   /transl_table=11
FT                   /gene="SCO5082"
FT                   /gene_synonym="actII-1"
FT                   /gene_synonym="SCBAC28G1.08c"
FT                   /product="putative transcriptional regulatory protein"
FT                   /note="SCBAC28G1.08c, actII-1, probable transcriptional
FT                   regulatory protein, len: 259 aa; identical to previously
FT                   sequenced TR:Q53901 (EMBL:M64683) Streptomyces coelicolor
FT                   ORF1-4 (ActII), 259 aa. Contains Pfam matches to entries
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and PF02909 tetR_C, Tetracyclin repressor, C-terminal
FT                   all-alpha domain and possible helix-turn-helix motif at
FT                   residues 53..73 (+2.78 SD)"
FT                   /db_xref="GOA:Q7AKH5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH5"
FT                   /protein_id="CAC44195.1"
FT                   /translation="MSRSEEGRPMPEEIPVPPWRRPKKAPPRMPLTQDRIVVTALGILD
FT                   AEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQV
FT                   KEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLL
FT                   STFVTAEALEQSSRNPGTEQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDS
FT                   DRRFELGLEIIIAGLLAGAGEAADDQVRTAGSPPAES"
     MSRSEEGRPM PEEIPVPPWR RPKKAPPRMP LTQDRIVVTA LGILDAEGLD ALSMRRLAQE        60
     LKTGHASLYA HVGNRDELLD LVFDIVLTEV EVPEPEPGRW AEQVKEMCRS LRRMFLAHRD       120
     LARIAIDRVP LGPNGMVGME RTMNLLRSGG LHDELAAYGG DLLSTFVTAE ALEQSSRNPG       180
     TEQGREQAGV FADQLHGYLK SLPATSFPNL VHLAGPITSL DSDRRFELGL EIIIAGLLAG       240
     AGEAADDQVR TAGSPPAES                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page