(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5084

AL939122.SCO5084     Location/Qualifiers
FT   CDS             155809..157944
FT                   /transl_table=11
FT                   /gene="SCO5084"
FT                   /gene_synonym="actII-3"
FT                   /gene_synonym="SCBAC28G1.10"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC28G1.10, actII-3, putative membrane protein,
FT                   len: 711 aa; identical to previously sequenced
FT                   SW:MMLA_STRCO (EMBL:M64683) Streptomyces coelicolor
FT                   putative membrane protein ActII-3, 711 aa. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q53902"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q53902"
FT                   /protein_id="CAC44197.1"
FT                   /translation="MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAA
FT                   AWLPGNAESTEVLELSEKFQPADTSPTVIVYDRPSGITAADEAKARADATHFADGTGVV
FT                   GEPYGPVRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTGPTG
FT                   YAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLL
FT                   AKNAGLTVNAQTAMILTVLVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPA
FT                   IVASAATVAVSMLVLLLAALNSTKGLGPVCAVGVLVGLLSMMTLLPALLVIFGRWVFWP
FT                   ARPKHGTEPDVTRGLWSRIARLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGF
FT                   KTKPESVVGEEILTRHFPAGSGEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGL
FT                   AYVEATLGAGADSPAAMRSVTAARETLARLDGAQARVGGSSAVVHDMREASSRDRGLII
FT                   PVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALFFNHVFDFAGADSAFPLW
FT                   VFVFLVALGVDYNIFLVTRIKEESDRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALA
FT                   TLPLVFIAELGFTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWPHPLARREDPSEDPAV
FT                   SGMPDSIDSEASTTASR"
     MTRTLLSWPG GRRLKWLVLA AWIGLLIVLQ PLAGKLGDVE SNDAAAWLPG NAESTEVLEL        60
     SEKFQPADTS PTVIVYDRPS GITAADEAKA RADATHFADG TGVVGEPYGP VRSDDGKALR       120
     TVVNVHLGKD GWEGLNAAAK DMRAIARPSA PDGLGVHVTG PTGYAADSAE SFSSADFKLT       180
     LVTLLIVVTI LVVTYRSPLL WLLPMISAGM SLVISQAIVY LLAKNAGLTV NAQTAMILTV       240
     LVLGAATDYA LLLVARYREE LRRHEDRHEA MAVALRRAGP AIVASAATVA VSMLVLLLAA       300
     LNSTKGLGPV CAVGVLVGLL SMMTLLPALL VIFGRWVFWP ARPKHGTEPD VTRGLWSRIA       360
     RLVSGRPRAV WVTTSLLLGA VATLAVTLNA DGLQQKDGFK TKPESVVGEE ILTRHFPAGS       420
     GEPMVVIAKG ASADQVHAAL ETVPGVIEVA PPQVKDGLAY VEATLGAGAD SPAAMRSVTA       480
     ARETLARLDG AQARVGGSSA VVHDMREASS RDRGLIIPVI LAVVFCILAL LLRALVAPLL       540
     LIASVVLSFF TALGLAALFF NHVFDFAGAD SAFPLWVFVF LVALGVDYNI FLVTRIKEES       600
     DRLGTRQGAL KGLTSTGGVI TAAGLVLAGT FAALATLPLV FIAELGFTVA VGVLLDTMIV       660
     RSVLVTALTL DVGRWMWWPH PLARREDPSE DPAVSGMPDS IDSEASTTAS R                711
//

If you have problems or comments...

PBIL Back to PBIL home page