(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5087

AL939122.SCO5087     Location/Qualifiers
FT   CDS             159801..161204
FT                   /transl_table=11
FT                   /gene="SCO5087"
FT                   /gene_synonym="actIORF1"
FT                   /gene_synonym="SCBAC28G1.13"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   alpha subunit"
FT                   /note="SCBAC28G1.13, actIORF1, actinorhodin polyketide
FT                   beta-ketoacyl synthase alpha subunit, len: 467 aa;
FT                   identical to C-terminal region of SW:KASA_STRCO
FT                   (EMBL:X63449) Streptomyces coelicolor actinorhodin
FT                   polyketide putative beta-ketoacyl synthase 1 ActI ORF1, 424
FT                   aa. Previously sequenced start codon at residue 44 of this
FT                   sequence. Also similar to TR:CAB45606 (EMBL:AL079356)
FT                   Streptomyces coelicolor polyketide beta-ketoacyl synthase
FT                   alpha (WhiE locus) SC6G9.15, 424 aa; fasta scores: opt:
FT                   1706 Z-score: 1660.2 bits: 316.4 E(): 9.5e-87; 61.871%
FT                   identity in 417 aa overlap. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain and match to
FT                   Prosite entry PS00606 Beta-ketoacyl synthases active site"
FT                   /db_xref="GOA:Q02059"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02059"
FT                   /protein_id="CAC44200.1"
FT                   /translation="MPLDAAPVDPASRGPVSAFEPPSSHGADDDDDHRTNASKELFGLK
FT                   RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAEG
FT                   FGPRELDRMDRASQFAVACAREAFAASGLDPDTLDPARVGVSLGSAVAAATSLEREYLL
FT                   LSDSGRDWEVDAAWLSRHMFDYLVPSVMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNA
FT                   VRAIEEGSADVMFAGAADTPITPIVVACFDAIRATTARNDDPEHASRPFDGTRDGFVLA
FT                   EGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESR
FT                   TDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEI
FT                   AACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLR
FT                   DAETAGAAA"
     MPLDAAPVDP ASRGPVSAFE PPSSHGADDD DDHRTNASKE LFGLKRRVVI TGVGVRAPGG        60
     NGTRQFWELL TSGRTATRRI SFFDPSPYRS QVAAEADFDP VAEGFGPREL DRMDRASQFA       120
     VACAREAFAA SGLDPDTLDP ARVGVSLGSA VAAATSLERE YLLLSDSGRD WEVDAAWLSR       180
     HMFDYLVPSV MPAEVAWAVG AEGPVTMVST GCTSGLDSVG NAVRAIEEGS ADVMFAGAAD       240
     TPITPIVVAC FDAIRATTAR NDDPEHASRP FDGTRDGFVL AEGAAMFVLE DYDSALARGA       300
     RIHAEISGYA TRCNAYHMTG LKADGREMAE TIRVALDESR TDATDIDYIN AHGSGTRQND       360
     RHETAAYKRA LGEHARRTPV SSIKSMVGHS LGAIGSLEIA ACVLALEHGV VPPTANLRTS       420
     DPECDLDYVP LEARERKLRS VLTVGSGFGG FQSAMVLRDA ETAGAAA                     467
//

If you have problems or comments...

PBIL Back to PBIL home page