(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5088

AL939122.SCO5088     Location/Qualifiers
FT   CDS             161201..162424
FT                   /transl_table=11
FT                   /gene="SCO5088"
FT                   /gene_synonym="actIORF2"
FT                   /gene_synonym="SCBAC28G1.14"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   beta subunit"
FT                   /note="SCBAC28G1.14, actIORF2, actinorhodin polyketide
FT                   beta-ketoacyl synthase beta subunit (also known as chain
FT                   length factor), len: 407 aa; identical to previously
FT                   sequenced SW:KASB_STRCO (EMBL:X63449) Streptomyces
FT                   coelicolor actinorhodin polyketide putative beta-ketoacyl
FT                   synthase 2 ActI ORF2, 407 aa. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain"
FT                   /db_xref="GOA:Q02062"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02062"
FT                   /protein_id="CAC44201.1"
FT                   /translation="MSVLITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPA
FT                   TLAGQIDDFHAPDHIPGRLLPQTDPSTRLALTAADWALQDAKADPESLTDYDMGVVTAN
FT                   ACGGFDFTHREFRKLWSEGPKSVSVYESFAWFYAVNTGQISIRHGMRGPSSALVAEQAG
FT                   GLDALGHARRTIRRGTPLVVSGGVDSALDPWGWVSQIASGRISTATDPDRAYLPFDERA
FT                   AGYVPGEGGAILVLEDSAAAEARGRHDAYGELAGCASTFDPAPGSGRPAGLERAIRLAL
FT                   NDAGTGPEDVDVVFADGAGVPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPL
FT                   DVVTALMSLREGVIAPTAGVTSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAV
FT                   LRRFAPTP"
     MSVLITGVGV VAPNGLGLAP YWSAVLDGRH GLGPVTRFDV SRYPATLAGQ IDDFHAPDHI        60
     PGRLLPQTDP STRLALTAAD WALQDAKADP ESLTDYDMGV VTANACGGFD FTHREFRKLW       120
     SEGPKSVSVY ESFAWFYAVN TGQISIRHGM RGPSSALVAE QAGGLDALGH ARRTIRRGTP       180
     LVVSGGVDSA LDPWGWVSQI ASGRISTATD PDRAYLPFDE RAAGYVPGEG GAILVLEDSA       240
     AAEARGRHDA YGELAGCAST FDPAPGSGRP AGLERAIRLA LNDAGTGPED VDVVFADGAG       300
     VPELDAAEAR AIGRVFGREG VPVTVPKTTT GRLYSGGGPL DVVTALMSLR EGVIAPTAGV       360
     TSVPREYGID LVLGEPRSTA PRTALVLARG RWGFNSAAVL RRFAPTP                     407
//

If you have problems or comments...

PBIL Back to PBIL home page