(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5092

AL939122.SCO5092     Location/Qualifiers
FT   CDS             164558..165091
FT                   /transl_table=11
FT                   /gene="SCO5092"
FT                   /gene_synonym="actVB"
FT                   /gene_synonym="SCBAC28G1.18"
FT                   /product="actinorhodin polyketide putative dimerase"
FT                   /note="SCBAC28G1.18, actVB, actinorhodin polyketide
FT                   possible dimerase, len: 177 aa; identical to previously
FT                   sequenced SW:DIM6_STRCO (EMBL:X63449) Streptomyces
FT                   coelicolor actinorhodin polyketide dimerase ActI ORF6,
FT                   ActVB, 177 aa Contains Pfam match to entry PF01613
FT                   Flavin_Reduct, Flavin reductase like domain"
FT                   /db_xref="GOA:Q02058"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02058"
FT                   /protein_id="CAC44205.1"
FT                   /translation="MAADQGMLRDAMARVPAGVALVTAHDRGGVPHGFTASSFVSVSME
FT                   PPLALVCLARTANSFPVFDSCGEFAVSVLREDHTDLAMRFARKSADKFAGGEFVRTARG
FT                   ATVLDGAVAVVECTVHERYPAGDHIILLGEVQSVHVEEKGVPAVYVDRRFAALCSAAGA
FT                   CPSATGRGVPAHAG"
     MAADQGMLRD AMARVPAGVA LVTAHDRGGV PHGFTASSFV SVSMEPPLAL VCLARTANSF        60
     PVFDSCGEFA VSVLREDHTD LAMRFARKSA DKFAGGEFVR TARGATVLDG AVAVVECTVH       120
     ERYPAGDHII LLGEVQSVHV EEKGVPAVYV DRRFAALCSA AGACPSATGR GVPAHAG          177
//

If you have problems or comments...

PBIL Back to PBIL home page