(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5098

AL939122.SCO5098     Location/Qualifiers
FT   CDS             169158..169622
FT                   /transl_table=11
FT                   /gene="SCO5098"
FT                   /gene_synonym="ORF12"
FT                   /gene_synonym="SCBAC28G1.24"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC28G1.24, possible integral membrane protein,
FT                   len: 154 aa; identical in its C-terminal domain to
FT                   TR:Q9X9U7 (EMBL:Y18817) Streptomyces coelicolor A3(2)
FT                   hypothetical 11.9 kDa protein ORF11, 113 aa. Contains
FT                   possible hydrophobic membrane spanning regions and 10x
FT                   degenerate repeat at N-terminal region: M(P/V). Alternative
FT                   start codon in previously sequence EMBL entrance after the
FT                   repeat region at residue 42"
FT                   /db_xref="GOA:Q93IY7"
FT                   /db_xref="InterPro:IPR021214"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY7"
FT                   /protein_id="CAC44211.1"
FT                   /translation="MPDCTRPCPIVPVPMPMPMPMPMPMPMPVPVPASVPNQESAVLSS
FT                   LKAVNLLVMFLLELAVYTAVVLWGVAVGGTWPVEVALGVGAPVVMMAAWALFGSPRARR
FT                   PARGAGRFVLEVLWFGAGAAALAASGRPWWAAALAGVCLVNAVLRRLWKQ"
     MPDCTRPCPI VPVPMPMPMP MPMPMPMPVP VPASVPNQES AVLSSLKAVN LLVMFLLELA        60
     VYTAVVLWGV AVGGTWPVEV ALGVGAPVVM MAAWALFGSP RARRPARGAG RFVLEVLWFG       120
     AGAAALAASG RPWWAAALAG VCLVNAVLRR LWKQ                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page