(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5100

AL939122.SCO5100     Location/Qualifiers
FT   CDS             171010..171762
FT                   /transl_table=11
FT                   /gene="SCO5100"
FT                   /gene_synonym="SCBAC28G1.26"
FT                   /product="putative gntR-family regulatory protein"
FT                   /note="SCBAC28G1.26, possible gntR-family regulatory
FT                   protein, len: 250 aa; low similarity to SW:FARR_ECOLI
FT                   (EMBL:X15790) Escherichia coli fatty acid responsive
FT                   regulator (P30 protein) FarR, 240 aa; fasta scores: opt:
FT                   206 Z-score: 237.6 bits: 51.4 E(): 1.3e-05; 25.926%
FT                   identity in 243 aa overlap. Contains Pfam match to entry
FT                   PF00392 gntR, Bacterial regulatory proteins, gntR family"
FT                   /db_xref="GOA:Q93IY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY5"
FT                   /protein_id="CAC44213.1"
FT                   /translation="MTFGEQPAYLRVAGDLRKKIADGLLPPHTRLPSQARIREEYGVSD
FT                   TVALEARKVLMAEGLVEGRSGSGTYVRERPVPRRVARSGYRPAGGATPFRQEQADGDAR
FT                   GTWESRSEQAEASGAVAERLGIKPGDRVMCTRYVFREAGEAVMLSTSWEPLDLTGRTPV
FT                   MLPEEGPLGGMGVVERMAAIDVVVDNVTEEVGARPGLAEELLALGGVPGHVVLVVQRTF
FT                   YASGRAVETADVVVPADRYRVAYHLPVR"
     MTFGEQPAYL RVAGDLRKKI ADGLLPPHTR LPSQARIREE YGVSDTVALE ARKVLMAEGL        60
     VEGRSGSGTY VRERPVPRRV ARSGYRPAGG ATPFRQEQAD GDARGTWESR SEQAEASGAV       120
     AERLGIKPGD RVMCTRYVFR EAGEAVMLST SWEPLDLTGR TPVMLPEEGP LGGMGVVERM       180
     AAIDVVVDNV TEEVGARPGL AEELLALGGV PGHVVLVVQR TFYASGRAVE TADVVVPADR       240
     YRVAYHLPVR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page