(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5101

AL939122.SCO5101     Location/Qualifiers
FT   CDS             172208..172399
FT                   /transl_table=11
FT                   /gene="SCO5101"
FT                   /gene_synonym="SCBAC28G1.27"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCBAC28G1.27, conserved hypothetical protein, len:
FT                   63 aa; similar to TR:Q9HTF6 (EMBL:AE004953) Pseudomonas
FT                   aeruginosa hypothetical protein PA5408, 58 aa; fasta
FT                   scores: opt: 146 Z-score: 225.2 bits: 45.1 E(): 6.2e-05;
FT                   45.652% identity in 46 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY4"
FT                   /protein_id="CAC44214.1"
FT                   /translation="MNDSTVTLPWLVFRQDDNGNRYRVGRYATRAEAQEIADTLDGRGH
FT                   KQLYWVEKLAAPGAGAAD"
     MNDSTVTLPW LVFRQDDNGN RYRVGRYATR AEAQEIADTL DGRGHKQLYW VEKLAAPGAG        60
     AAD                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page