(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5102

AL939122.SCO5102     Location/Qualifiers
FT   CDS             172475..172909
FT                   /transl_table=11
FT                   /gene="SCO5102"
FT                   /gene_synonym="SCBAC28G1.28"
FT                   /product="putative mutT-like protein"
FT                   /note="SCBAC28G1.28, possible mutT-like protein, len: 144
FT                   aa; similar to SW:MUTT_ECOLI (EMBL:X04831) Escherichia coli
FT                   mutator MutT protein
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.*)
FT                   MutT, 129 aa; fasta scores: opt: 190 Z-score: 228.6 bits:
FT                   48.1 E(): 4e-05; 33.333% identity in 132 aa overlap.
FT                   Contains Pfam match to entry PF00293 mutT, MutT-like domain
FT                   and match to Prosite entry PS00893 mutT domain signature"
FT                   /db_xref="GOA:Q93IY3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY3"
FT                   /protein_id="CAC44215.1"
FT                   /translation="MTERIVVGAALLDGGRLLAARRSAPAELAGRWELPGGKVEPGETP
FT                   EAALVRELREELGVAAEAGGRVPGQWPLRAPFVLQVWTARLRPGSAAPAPLEDHDELRW
FT                   LTPGQIWDVPWLDQDVPAVERVLAHLGLEAGTGRNGTGPG"
     MTERIVVGAA LLDGGRLLAA RRSAPAELAG RWELPGGKVE PGETPEAALV RELREELGVA        60
     AEAGGRVPGQ WPLRAPFVLQ VWTARLRPGS AAPAPLEDHD ELRWLTPGQI WDVPWLDQDV       120
     PAVERVLAHL GLEAGTGRNG TGPG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page