(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5106

AL939122.SCO5106     Location/Qualifiers
FT   CDS             complement(177828..178607)
FT                   /transl_table=11
FT                   /gene="SCO5106"
FT                   /gene_synonym="SCBAC31E11.02c"
FT                   /gene_synonym="shdB2"
FT                   /product="putative succinate dehydrogenase iron-sulfur
FT                   subunit"
FT                   /note="SCBAC31E11.02c, shdB2, probable succinate
FT                   dehydrogenase iron-sulfur subunit, len: 259 aa; highly
FT                   similar to TR:AAK44479 (EMBL:AE006934) Mycobacterium
FT                   tuberculosis ferredoxin, 2Fe-2S MT0261, 248 aa; fasta
FT                   scores: opt: 1355 Z-score: 1588.1 bits: 301.4 E(): 7.7e-81;
FT                   74.900% identity in 251 aa overlap and to SW:DHSB_BACSU
FT                   (EMBL:M13470) Bacillus subtilis succinate dehydrogenase
FT                   iron-sulfur protein SdhB, 252 aa; fasta scores: opt: 365
FT                   Z-score: 434.1 bits: 87.9 E(): 1.4e-16; 30.603% identity in
FT                   232 aa overlap. Contains Pfam match to entry PF00111 fer2,
FT                   2Fe-2S iron-sulfur cluster binding domains"
FT                   /db_xref="GOA:Q93IU9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU9"
FT                   /protein_id="CAC44313.1"
FT                   /translation="MSGYEARFKVWRGDVAGGGLEDFTVEVNDGEVVLDIIHRLQATQA
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSVFTREETITVTPLRAFPVIRDLVTD
FT                   VGFNYTKAREVPAFVPPADLGPGEYRMMQEDVDRSQEFRKCIECFLCQDTCHVVRDHEE
FT                   NKPAFAGPRFLMRVAELDMHPLDAAGDTGLDRSRTAQDEHGLGFCNITKCCTEVCPEGI
FT                   RITDNALIPLKERAVDRKYDPLVWLGAKIGRRSRDTP"
     MSGYEARFKV WRGDVAGGGL EDFTVEVNDG EVVLDIIHRL QATQAPDLAV RWNCKAGKCG        60
     SCSAEINGRP RLLCMTRMSV FTREETITVT PLRAFPVIRD LVTDVGFNYT KAREVPAFVP       120
     PADLGPGEYR MMQEDVDRSQ EFRKCIECFL CQDTCHVVRD HEENKPAFAG PRFLMRVAEL       180
     DMHPLDAAGD TGLDRSRTAQ DEHGLGFCNI TKCCTEVCPE GIRITDNALI PLKERAVDRK       240
     YDPLVWLGAK IGRRSRDTP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page