(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5108

AL939122.SCO5108     Location/Qualifiers
FT   CDS             complement(180582..181418)
FT                   /transl_table=11
FT                   /gene="SCO5108"
FT                   /gene_synonym="SCBAC31E11.04c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC31E11.04c, possible integral membrane protein,
FT                   len: 278 aa; similar to TR:O53671 (EMBL:AL021929)
FT                   Mycobacterium tuberculosis hypothetical 31.1 kDa protein
FT                   MTV034.15c, 273 aa; fasta scores: opt: 1010 Z-score: 1230.3
FT                   bits: 235.4 E(): 6.5e-61; 54.545% identity in 275 aa
FT                   overlap. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q93IU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU7"
FT                   /protein_id="CAC44315.1"
FT                   /translation="MATGTEPPATEDRPPGGGVHTPTRAAIRARHLRTDRWWLAPAATA
FT                   AGLLAFVVYSTWRAFANADYYAAPYVSPFYSPCLAENCEPMRSGPNWELFGTWWGISPA
FT                   IIILIFPLGFRLTCYYYRKAYYRGFWASPPACAVAEPHRKYTGETRFPLILQNVHRYFF
FT                   YAALLVAGILSYDTVLAFRDEHYAWGHMGLGTLVFLANIALIWAYTLSCHSCRHIVGGK
FT                   LKHFSRHPVRYRMWQLVGRLNARHMQLAWASLVSVALADFYVYLVASGVFDDPRFF"
     MATGTEPPAT EDRPPGGGVH TPTRAAIRAR HLRTDRWWLA PAATAAGLLA FVVYSTWRAF        60
     ANADYYAAPY VSPFYSPCLA ENCEPMRSGP NWELFGTWWG ISPAIIILIF PLGFRLTCYY       120
     YRKAYYRGFW ASPPACAVAE PHRKYTGETR FPLILQNVHR YFFYAALLVA GILSYDTVLA       180
     FRDEHYAWGH MGLGTLVFLA NIALIWAYTL SCHSCRHIVG GKLKHFSRHP VRYRMWQLVG       240
     RLNARHMQLA WASLVSVALA DFYVYLVASG VFDDPRFF                               278
//

If you have problems or comments...

PBIL Back to PBIL home page