(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5110

AL939122.SCO5110     Location/Qualifiers
FT   CDS             182093..184408
FT                   /transl_table=11
FT                   /gene="SCO5110"
FT                   /gene_synonym="SCBAC31E11.06"
FT                   /product="putative lipoprotein"
FT                   /note="SCBAC31E11.06, possible lipoprotein, len: 771 aa;
FT                   similar to SW:YC80_MYCTU (EMBL:Z77137) Mycobacterium
FT                   tuberculosis hypothetical 63.5 kDa protein MTCY50.02, 591
FT                   aa; fasta scores: opt: 565 Z-score: 501.6 bits: 103.2 E():
FT                   2.5e-20; 26.190% identity in 756 aa overlap. Contains
FT                   correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site and
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q93IU5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU5"
FT                   /protein_id="CAC44317.1"
FT                   /translation="MSHVGVGPRAVMRAVAFLTTGVLAVPALAGCTSEDPAGKPLAEQD
FT                   VAAAARARISDGGTLRWAVDSVPDTLNAFQSDADATTTRVAQAVLPSMYRMDETGSPVR
FT                   NPDYLESAEVVDTEPKQVVVYKLNQQAVWSDGREIGAADFAAQWRALSGKDSAYWTARN
FT                   AGYDRIEKVERGANDLEVKVTFSRPYADWKALFTPLYPKDVTGTPDAFNDGARRALKVS
FT                   AGPFAVKKVDTKGDQVVLTGNPRWWGEPAKLDEIVLRAVPRDERVSELVAGKLDLAEID
FT                   PETADEVTLAAGPRDPATGTPLMGPGGTPAAGPQGRSAAEALRSWAIANGSDEEAAEEE
FT                   VLAREERGEAEAKARRRQQALSGFELRKSLEPAYTQLALNGAEGPLADERVRRAVARAL
FT                   DREELAEAVLKPLGLPAEPVGSHLALSGQPAYADGSGALGEQNAKEARALLADAGWVPG
FT                   GPVKKKDGEEAAGAEKDENKDEDKKDEEKSEGGDDGTYIVGEDDKNKDGKNKDGKNDDG
FT                   KNDDGGNDDGGNDDAGDAKDGADRESGEKHSSGKNTAQGGAPGAYAPKGTAAPAGAAAA
FT                   PLAKDGKELTLRFVLPSGPGSGTLRTVADRITDMLKEIGIGTRITKVPDESYFKDHIAA
FT                   GEYDLALYSWPASAFPATDARPIYAKPVPAADGSLNVAQNYTRVGTDQVDQLFDRALAT
FT                   LDQKESRDLLRKADSRIWAAAGSVPLYQRPQLTAARKNLANAGAFGFGTPVYEDMGFLK
FT                   KGAQGSRPTAPASPSPSS"
     MSHVGVGPRA VMRAVAFLTT GVLAVPALAG CTSEDPAGKP LAEQDVAAAA RARISDGGTL        60
     RWAVDSVPDT LNAFQSDADA TTTRVAQAVL PSMYRMDETG SPVRNPDYLE SAEVVDTEPK       120
     QVVVYKLNQQ AVWSDGREIG AADFAAQWRA LSGKDSAYWT ARNAGYDRIE KVERGANDLE       180
     VKVTFSRPYA DWKALFTPLY PKDVTGTPDA FNDGARRALK VSAGPFAVKK VDTKGDQVVL       240
     TGNPRWWGEP AKLDEIVLRA VPRDERVSEL VAGKLDLAEI DPETADEVTL AAGPRDPATG       300
     TPLMGPGGTP AAGPQGRSAA EALRSWAIAN GSDEEAAEEE VLAREERGEA EAKARRRQQA       360
     LSGFELRKSL EPAYTQLALN GAEGPLADER VRRAVARALD REELAEAVLK PLGLPAEPVG       420
     SHLALSGQPA YADGSGALGE QNAKEARALL ADAGWVPGGP VKKKDGEEAA GAEKDENKDE       480
     DKKDEEKSEG GDDGTYIVGE DDKNKDGKNK DGKNDDGKND DGGNDDGGND DAGDAKDGAD       540
     RESGEKHSSG KNTAQGGAPG AYAPKGTAAP AGAAAAPLAK DGKELTLRFV LPSGPGSGTL       600
     RTVADRITDM LKEIGIGTRI TKVPDESYFK DHIAAGEYDL ALYSWPASAF PATDARPIYA       660
     KPVPAADGSL NVAQNYTRVG TDQVDQLFDR ALATLDQKES RDLLRKADSR IWAAAGSVPL       720
     YQRPQLTAAR KNLANAGAFG FGTPVYEDMG FLKKGAQGSR PTAPASPSPS S                771
//

If you have problems or comments...

PBIL Back to PBIL home page