(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5114

AL939122.SCO5114     Location/Qualifiers
FT   CDS             190414..191391
FT                   /transl_table=11
FT                   /gene="SCO5114"
FT                   /gene_synonym="bldKC"
FT                   /gene_synonym="SCBAC31E11.10"
FT                   /product="BldKC, putative ABC transport system integral
FT                   membrane protein"
FT                   /note="SCBAC31E11.10, bldKC, possible ABC transport system
FT                   integral membrane protein, len: 325 aa; almost identical to
FT                   previously sequenced TR:P72408 (EMBL:U68036) Streptomyces
FT                   coelicolor BldKC, 323 aa. Contains Pfam match to entry
FT                   PF00528 BPD_transp, Binding-protein-dependent transport
FT                   systems inner membrane component. Also contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q93IU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU1"
FT                   /protein_id="CAC44321.1"
FT                   /translation="MLQFLIRRSFGAVLILVLISAFTFFMFFAIPQDPAMLACGKNCTP
FT                   DALEIIHKNLGLDQPVTVQYWHFLAGIFTGRDFAVGHCDAPCFGVSFANNQNVWDTILD
FT                   RFPLTVSLTVGSLIVFLIVGLGAGLLAAKNRGTWIDKVFSSGSLVVSSLQIYFLGPLVL
FT                   LALVYSTGWLQKPKYVPISEDAAGWFAGLLIPWIVMATIFTANYTRMSRSSMIEQLQEE
FT                   HVRAARAKGMSSNYTFFRYAWRGSLVPIVTILGIDLSALMGGGMVTEMTFGLAGIGRLA
FT                   LESVINKDLPMLMGVMLVSAALIIVFNLIVDAMYAVIDPRVRLS"
     MLQFLIRRSF GAVLILVLIS AFTFFMFFAI PQDPAMLACG KNCTPDALEI IHKNLGLDQP        60
     VTVQYWHFLA GIFTGRDFAV GHCDAPCFGV SFANNQNVWD TILDRFPLTV SLTVGSLIVF       120
     LIVGLGAGLL AAKNRGTWID KVFSSGSLVV SSLQIYFLGP LVLLALVYST GWLQKPKYVP       180
     ISEDAAGWFA GLLIPWIVMA TIFTANYTRM SRSSMIEQLQ EEHVRAARAK GMSSNYTFFR       240
     YAWRGSLVPI VTILGIDLSA LMGGGMVTEM TFGLAGIGRL ALESVINKDL PMLMGVMLVS       300
     AALIIVFNLI VDAMYAVIDP RVRLS                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page