(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5116

AL939122.SCO5116     Location/Qualifiers
FT   CDS             192491..193636
FT                   /transl_table=11
FT                   /gene="SCO5116"
FT                   /gene_synonym="SC9E12.01"
FT                   /gene_synonym="bldKE"
FT                   /gene_synonym="SCBAC31E11.12"
FT                   /product="putative peptide transport system ATP-binding
FT                   subunit"
FT                   /note="SC9E12.01, probable peptide transport system
FT                   ATP-binding protein (fragment), len: >142 aa; similar to
FT                   SW:OPPF_ECOLI (EMBL:AE000223) Escherichia coli oligopeptide
FT                   transport protein ATP-binding protein OppF, 334 aa; fasta
FT                   scores: opt: 344 z-score: 423.0 E(): 4.3e-16; 56.5%
FT                   identity in 92 aa overlap and to TR:O86575 (EMBL:AL031184)
FT                   Streptomyces coelicolor oligopeptide ABC transporter
FT                   ATP-binding protein SC2A11.14, 496 aa; fasta scores: opt:
FT                   488 z-score: 576.6 E(): 1.7e-26; 56.6% identity in 136 aa
FT                   overlap"
FT                   /note="SCBAC31E11.12, bldKE, putative ABC transporter
FT                   intracellular ATPase subunit (fragment), len: >272 aa;
FT                   almost identical to previously sequenced TR:P72410
FT                   (EMBL:U68036) Streptomyces coelicolor putative ABC
FT                   transporter intracellular ATPase subunit (fragment) BldKE,
FT                   284 aa and similar to N-terminal region of TR:O86575
FT                   (EMBL:AL031184) Streptomyces coelicolor SC2A11.14, 497 aa;
FT                   fasta scores: opt: 1186 Z-score: 1170.6 bits: 225.2 E():
FT                   1.7e-59; 63.603% identity in 272 aa overlap. Contains Pfam
FT                   match to entry PF00005 ABC_tran, ABC transporter and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00211 ABC transporters family
FT                   signature"
FT                   /db_xref="GOA:Q8CJS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS2"
FT                   /protein_id="CAD55223.1"
FT                   /translation="MSDNSKTTTAVADDFPQQRDGDTAPLLKVSGLSKHFPIKGGFPIK
FT                   RTVGHVKAVDGVDFEVFPGESLGLVGESGCGKSTTGRLLTRLYEPTQGSIEYRGKDITR
FT                   ANRRELAPVRSEIQMIFQDPYASLNPRQTVGTIISGPMEINGINPPGGREKRVRELLEI
FT                   VGLNPEHYNRFPHEFSGGQRQRIGVARAVALQPKLIVADEPVSALDVSIQAQVVNLLQE
FT                   VQREMGIAFVFIAHDLAIVRHFSQRVAVMYLGKIVEIADRDSLYNRPRHPYTHALLSAV
FT                   PETDLDAEKRERIRLEGDVPSPISPPSGCRFRTRCWKAQDKCATEEPPLVQLSGNREGH
FT                   LTACHFPEEGSTEARAEDIVMDPGLKAMEDGADGGATLSKG"
     MSDNSKTTTA VADDFPQQRD GDTAPLLKVS GLSKHFPIKG GFPIKRTVGH VKAVDGVDFE        60
     VFPGESLGLV GESGCGKSTT GRLLTRLYEP TQGSIEYRGK DITRANRREL APVRSEIQMI       120
     FQDPYASLNP RQTVGTIISG PMEINGINPP GGREKRVREL LEIVGLNPEH YNRFPHEFSG       180
     GQRQRIGVAR AVALQPKLIV ADEPVSALDV SIQAQVVNLL QEVQREMGIA FVFIAHDLAI       240
     VRHFSQRVAV MYLGKIVEIA DRDSLYNRPR HPYTHALLSA VPETDLDAEK RERIRLEGDV       300
     PSPISPPSGC RFRTRCWKAQ DKCATEEPPL VQLSGNREGH LTACHFPEEG STEARAEDIV       360
     MDPGLKAMED GADGGATLSK G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page