(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5117

AL939122.SCO5117     Location/Qualifiers
FT   CDS             193836..195470
FT                   /transl_table=11
FT                   /gene="SCO5117"
FT                   /gene_synonym="SC9E12.02"
FT                   /product="putative peptide transport system secreted
FT                   peptide-binding protein"
FT                   /note="SC9E12.02, possible peptide transport system
FT                   secreted peptide-binding protein, len: 544 aa; similar to
FT                   SW:OPPA_BACSU (EMBL:X56347) Bacillus subtilis
FT                   oligopeptide-binding protein OppA precursor, 545 aa; fasta
FT                   scores: opt: 648 z-score: 642.6 E(): 2.5e-28; 26.1%
FT                   identity in 552 aa overlap and to TR:P72407 (EMBL:U68036)
FT                   Streptomyces coelicolor SpoOKA homologue BldKB, 602 aa;
FT                   blastp scores: Score = 165 (58.1 bits), Expect = 2.9e-10,
FT                   Sum P(2) = 2.9e-10; Identities = 116/502 (23%), Positives =
FT                   202/502 (40%). Contains 2x Pfam matches to entry PF00496
FT                   SBP_bac_5, Bacterial extracellular solute-binding proteins,
FT                   family 5 and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Also contains possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="GOA:Q9F353"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F353"
FT                   /protein_id="CAC05747.1"
FT                   /translation="MRGATHARWAACAAAVALAATACGGGGGDGGSGGGSGGVLSSSWG
FT                   DPQNPLEPANTNEVQGGKVLDMIFRGLKKYDPGTGEAQNMLAEKIDTSDSQNFTVTVKD
FT                   GWTFSNGEKVTAQSFVDAWNYGASLKNNQRNAYFFAYIDGYDKVHPESGSQSTDTLSGL
FT                   KVTGPRTFTIKLSQKFSTFPDTLGYPAFAPLPKAFFDDHDAWLKKPVGNGPYQVDNYTR
FT                   GSQMSLRKWDDYPGPDKAQNGGVDLKVYTDNNTAYTDLIAGNLDLVDDVPASQLKNVKN
FT                   DLGDRYINTPAGIIQTLAFPFYDNDWNKSGSEKVRKGLSMAIDRKQITDTIFQNTRTPA
FT                   TDWTSPVLGKDGGYKPGLCGDACEYNAAEAKKLVKEGGGLPGGQVKITYNADTGSHKQW
FT                   VDAVCNSINNALDNDRACAGNPVGTFADFRNQITNQKMSGPFRAGWQMDYPLIQNFLQP
FT                   LYYTNASSNDGKWSSKKFDDLVDQANAETDTAKAVGLFQQAEEVLRDDMGAIPLWYQNG
FT                   SAGYSDRLSNVKLNPFSVPVYNEIKVG"
     MRGATHARWA ACAAAVALAA TACGGGGGDG GSGGGSGGVL SSSWGDPQNP LEPANTNEVQ        60
     GGKVLDMIFR GLKKYDPGTG EAQNMLAEKI DTSDSQNFTV TVKDGWTFSN GEKVTAQSFV       120
     DAWNYGASLK NNQRNAYFFA YIDGYDKVHP ESGSQSTDTL SGLKVTGPRT FTIKLSQKFS       180
     TFPDTLGYPA FAPLPKAFFD DHDAWLKKPV GNGPYQVDNY TRGSQMSLRK WDDYPGPDKA       240
     QNGGVDLKVY TDNNTAYTDL IAGNLDLVDD VPASQLKNVK NDLGDRYINT PAGIIQTLAF       300
     PFYDNDWNKS GSEKVRKGLS MAIDRKQITD TIFQNTRTPA TDWTSPVLGK DGGYKPGLCG       360
     DACEYNAAEA KKLVKEGGGL PGGQVKITYN ADTGSHKQWV DAVCNSINNA LDNDRACAGN       420
     PVGTFADFRN QITNQKMSGP FRAGWQMDYP LIQNFLQPLY YTNASSNDGK WSSKKFDDLV       480
     DQANAETDTA KAVGLFQQAE EVLRDDMGAI PLWYQNGSAG YSDRLSNVKL NPFSVPVYNE       540
     IKVG                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page