(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5118

AL939122.SCO5118     Location/Qualifiers
FT   CDS             195480..196403
FT                   /transl_table=11
FT                   /gene="SCO5118"
FT                   /gene_synonym="SC9E12.03"
FT                   /product="putative peptide transport system integral
FT                   membrane protein"
FT                   /note="SC9E12.03, probable peptide transport system
FT                   integral membrane protein, len: 307 aa; similar to TR:
FT                   SW:OPPB_BACSU (EMBL:X56347) Bacillus subtilis oligopeptide
FT                   transport system permease protein OppB, 311 aa; fasta
FT                   scores: opt: 688 z-score: 788.7 E(): 0; 36.0% identity in
FT                   308 aa overlap and to TR:P72408 (EMBL:U68036) Streptomyces
FT                   coelicolor SpoOKC homologue BldKC, 323 aa; blastp scores:
FT                   Score = 354 (124.6 bits), Expect = 1.9e-32, P = 1.9e-32;
FT                   Identities = 82/235 (34%), Positives = 138/235 (58%).
FT                   Contains Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component. Also contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9F352"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F352"
FT                   /protein_id="CAC05748.1"
FT                   /translation="MGRYVVRRLLQMIPVFIGATLLIFLMVNVMGDPIAGLCGDRECDP
FT                   ATAAQLRHEFGLDQPVWQQYATYMGNVFTGDFGTAFNGQPVTELMGTAFPVTIRLTIVA
FT                   ILFEIVVGIILGVLTGLRRGRPVDTGVLLLTLVVISVPTFVTGLLLQLLLGVKWGWIDP
FT                   AVSSEAAFGELIVPGLVLASVSLAYVTRLTRTSIAENRRSDYVRTAIAKGLPRHRVITR
FT                   HLLRNSLIPVVTFIGTDIGALMGGAIVTERIFNIHGVGYQLYQGILRQNTQTVVGFVTV
FT                   LVLVFLVANLVVDLLYAVLDPRIRYA"
     MGRYVVRRLL QMIPVFIGAT LLIFLMVNVM GDPIAGLCGD RECDPATAAQ LRHEFGLDQP        60
     VWQQYATYMG NVFTGDFGTA FNGQPVTELM GTAFPVTIRL TIVAILFEIV VGIILGVLTG       120
     LRRGRPVDTG VLLLTLVVIS VPTFVTGLLL QLLLGVKWGW IDPAVSSEAA FGELIVPGLV       180
     LASVSLAYVT RLTRTSIAEN RRSDYVRTAI AKGLPRHRVI TRHLLRNSLI PVVTFIGTDI       240
     GALMGGAIVT ERIFNIHGVG YQLYQGILRQ NTQTVVGFVT VLVLVFLVAN LVVDLLYAVL       300
     DPRIRYA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page