(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5122

AL939122.SCO5122     Location/Qualifiers
FT   CDS             complement(199564..201687)
FT                   /transl_table=11
FT                   /gene="SCO5122"
FT                   /gene_synonym="SC9E12.07c"
FT                   /product="putative peptidase"
FT                   /note="SC9E12.07c, probable peptidase, len: 707 aa; similar
FT                   to TR:P95782 (EMBL:D83263) Xanthomonas maltophilia
FT                   dipeptidyl peptidase IV, 741 aa; fasta scores: opt: 442
FT                   z-score: 478.1 E(): 3.7e-19; 33.2% identity in 733 aa
FT                   overlap. Contains Pfam matches to entries PF00930
FT                   DPPIV_N_term, Dipeptidyl peptidase IV (DPP IV) N-terminal
FT                   region and PF00326 Peptidase_S9, Prolyl oligopeptidase
FT                   family and match to Prosite entry PS00708 Prolyl
FT                   endopeptidase family serine active site"
FT                   /db_xref="GOA:Q9F348"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F348"
FT                   /protein_id="CAC05752.1"
FT                   /translation="MTTESDSFPKRHARTQRFTLGAPRSFTVAPDGSRVAFLRSGTGTD
FT                   RANSLWVLDAEKGGERMAADPRALLGGAQERLSPEERARRERSREGGAGIVGYATDSSV
FT                   ELASFALSGRLFVAELQVGTARELPTPGPVIDPRPSPDGRHVAYVAQGALRVVGAEGDG
FT                   DRALAEADGEGVTYGLAEFVAAEEMSRSRGFWWSPESDRLLVARVDDTPVQRWWISDPA
FT                   HPGRDPQHVPYPAAGTPNADVRLFVVGLDGGRTEVLWDRARYPYLARVHWSAAGAPLLL
FT                   VQARDQRSQLFLAVDTESGTTRMVHADEDPIWLELFPGVPYWSPSGQLVRIADEGGARV
FT                   LAVGERLLTGAQLHLRAVLDVGADDVLVSASAGEEAAEAEIGEVHVYRVNELGVERLSQ
FT                   EPGVHSAVRAGGVTVLVSATLDRPGARVRVLRDGKAAATIASYAEDPGLSPRVTLTQGG
FT                   ARRVPCAVLMPTDYHGDTPLPVLLDPYGGPHGQRVVAAHNAHLTSQWFADQGFAVVVAD
FT                   GRGTPGRSPAWEKAVKDDVAAVVLQDQVDALHALAADFPLDLDRVAVRGWSFGGYLAAL
FT                   AALRRPDVFHAAVVGAPVTDLRLYDTHYQERYLGDPGEQPDVYRRNSVIDDAGLVDAAE
FT                   PHRPMMVIHGLADDNVVVAHSLRLSSALLAAGRPHEVLPLSGVTHMTPQESVAENLLRL
FT                   QVDFLKRSLPAPA"
     MTTESDSFPK RHARTQRFTL GAPRSFTVAP DGSRVAFLRS GTGTDRANSL WVLDAEKGGE        60
     RMAADPRALL GGAQERLSPE ERARRERSRE GGAGIVGYAT DSSVELASFA LSGRLFVAEL       120
     QVGTARELPT PGPVIDPRPS PDGRHVAYVA QGALRVVGAE GDGDRALAEA DGEGVTYGLA       180
     EFVAAEEMSR SRGFWWSPES DRLLVARVDD TPVQRWWISD PAHPGRDPQH VPYPAAGTPN       240
     ADVRLFVVGL DGGRTEVLWD RARYPYLARV HWSAAGAPLL LVQARDQRSQ LFLAVDTESG       300
     TTRMVHADED PIWLELFPGV PYWSPSGQLV RIADEGGARV LAVGERLLTG AQLHLRAVLD       360
     VGADDVLVSA SAGEEAAEAE IGEVHVYRVN ELGVERLSQE PGVHSAVRAG GVTVLVSATL       420
     DRPGARVRVL RDGKAAATIA SYAEDPGLSP RVTLTQGGAR RVPCAVLMPT DYHGDTPLPV       480
     LLDPYGGPHG QRVVAAHNAH LTSQWFADQG FAVVVADGRG TPGRSPAWEK AVKDDVAAVV       540
     LQDQVDALHA LAADFPLDLD RVAVRGWSFG GYLAALAALR RPDVFHAAVV GAPVTDLRLY       600
     DTHYQERYLG DPGEQPDVYR RNSVIDDAGL VDAAEPHRPM MVIHGLADDN VVVAHSLRLS       660
     SALLAAGRPH EVLPLSGVTH MTPQESVAEN LLRLQVDFLK RSLPAPA                     707
//

If you have problems or comments...

PBIL Back to PBIL home page