(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5125

AL939122.SCO5125     Location/Qualifiers
FT   CDS             complement(202261..203124)
FT                   /transl_table=11
FT                   /gene="SCO5125"
FT                   /gene_synonym="SC9E12.10c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC9E12.10c, hypothetical protein, len: 287 aa;
FT                   similar to TR:Q9RDR4 (EMBL:AL136500) Streptomyces
FT                   coelicolor hypothetical 31.7 kDa protein SC1G2.15c, 284 aa;
FT                   fasta scores: opt: 1240 z-score: 1466.1 E(): 0; 67.2%
FT                   identity in 287 aa overlap"
FT                   /db_xref="GOA:Q9F345"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F345"
FT                   /protein_id="CAC05755.1"
FT                   /translation="MSVDAGTDQVDEPGWEVDPDDDWALAVIATVGRQLRLRREAAGMR
FT                   APDFAVAIGYGEDLVYKVEGGRRIPRPEYLDRADEVLTAGGLVAAMKEDVKKVRYPKKV
FT                   RDLAQMEARAVELQLYDPVNVHGLLQTPDYARALFRMRRPRYAEDEIERGVAARTARKA
FT                   VFERDPAPELGFVQDEWTLRRRLGGTDVVRRQLEHLLMLGRLPNVEIQVMPMDREEHAG
FT                   VDGAIEVLKFEDGTAVGRSPGVANGRPVTDLRQVRILELRYGIIRAQALTPCESAAFIE
FT                   QLLGET"
     MSVDAGTDQV DEPGWEVDPD DDWALAVIAT VGRQLRLRRE AAGMRAPDFA VAIGYGEDLV        60
     YKVEGGRRIP RPEYLDRADE VLTAGGLVAA MKEDVKKVRY PKKVRDLAQM EARAVELQLY       120
     DPVNVHGLLQ TPDYARALFR MRRPRYAEDE IERGVAARTA RKAVFERDPA PELGFVQDEW       180
     TLRRRLGGTD VVRRQLEHLL MLGRLPNVEI QVMPMDREEH AGVDGAIEVL KFEDGTAVGR       240
     SPGVANGRPV TDLRQVRILE LRYGIIRAQA LTPCESAAFI EQLLGET                     287
//

If you have problems or comments...

PBIL Back to PBIL home page